Details for Lyrate rockcress Locus 16064742

Position : sca3 ( 5`- 9795003 .. 9793882 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064742

Protein [Map View]
MYVEIDSTNLLSTPLTDVVACLIFFVYNKKTDKYFTIRDTEVKRFNALRTVWGLSQVLSLETFNDPKNGYIFEGDQCEFG
VDVLVAPSLTKWEVVSFNQKISNPKFSWTLKKFKELKEEFYDSVKFLVGGRQWFLKVYPKGDIRARDKSLSIYLFLSKSE
TLNAEEKIYTRVHVRLLDPLGSTHHVAWTLTYWYTKQNTGYGWDKFASLDKLRAQYLDNEGSLNIEIEFAVVSSTKYSPS
V*

DNA
ATGTATGTGGAGATTGATAGCACAAACCTCTTGTCAACGCCACTAACTGATGTGGTTGCATGTCTCATATTCTTTGTTTA
CAACAAGAAAACAGACAAATACTTTACTATTAGAGATACAGAAGTGAAGCGGTTCAATGCATTGAGAACAGTCTGGGGAT
TGTCTCAAGTCCTTTCGCTCGAAACTTTCAATGACCCTAAAAACGGATATATCTTCGAGGGAGATCAATGTGAATTTGGT
GTTGATGTCTTGGTTGCTCCATCCCTTACTAAATGGGAAGTCGTGTCCTTTAATCAGAAAATCTCTAATCCCAAGTTCTC
GTGGACTCTCAAGAAATTTAAAGAGTTAAAAGAGGAATTTTACGACTCAGTAAAGTTTTTAGTAGGAGGAAGGCAATGGT
TTCTAAAGGTGTATCCTAAGGGTGATATTAGAGCACGAGACAAGTCGTTATCCATTTATTTGTTCTTAAGTAAGAGTGAA
ACACTCAACGCAGAGGAGAAAATCTACACGCGAGTACATGTTAGACTTTTAGATCCTCTTGGATCCACTCATCACGTCGC
TTGGACATTGACCTACTGGTACACAAAGCAAAACACAGGCTATGGCTGGGATAAATTTGCGTCTTTAGATAAACTCCGGG
CGCAGTACTTGGACAATGAGGGTTCTTTGAATATAGAGATTGAATTTGCAGTTGTTTCAAGCACCAAATACTCTCCCAGT
GTCTAA