Details for Lyrate rockcress Locus 16064738

Position : sca3 ( 5`- 6820213 .. 6822976 -3` )
Annotation : [B2G] nucleic acid binding protein
External links : CoGe
PGDD synteny : 16064738

Protein [Map View]
MLAYRTLFRIDRVFGVTSRCFLSKTESFSILSFRGSENSAMDGFKKQKMFNRMIHPGFESFHLLWLSHDETEAGNEVQEV
AQCSKSSDVSEEVIKGGVNETASVVSAGKHSVSLEVGASLIKFIRGKEGTTQMKLEEEMGVKIILPSSRNEDHISIEGGS
VECVTKASERIATIIDEVVRSPSLDYSHFVSLPLAIHPELVDKLVNFQNSILGNHSIARDKQDDQANRETTSVAVDLKAN
SETNKVNVDIKSIPIVSYPPKAKSKSSTLLDLGIEKSIFIKPSTFHLTVVMLKLWNKDRVNAAGDVLKSISPSVMDALDK
KPVFIRLKGLDCMRGPLAKTRVLYAPVEEIGDEGRLLRACRILIFKVITDAFVKAGLVLEKDAKQSLKLHVTVMNARHRK
RRKNNKKKMETFDAREIHKQFGNEDWGEYLIREAHLSQRFVFDQNGYYRCCASIPFPGEHTA*

DNA
ATGTTAGCTTACAGGACTCTGTTTAGGATTGATCGTGTGTTTGGGGTTACGAGTAGATGTTTTCTATCGAAAACGGAATC
TTTTAGTATCTTGAGCTTTAGGGGAAGTGAGAACAGTGCCATGGATGGATTCAAGAAGCAGAAGATGTTTAATCGTATGA
TCCATCCCGGTTTTGAAAGTTTCCACCTTCTGTGGCTTTCTCATGATGAGACAGAAGCTGGAAATGAAGTCCAAGAAGTA
GCTCAGTGTAGCAAATCAAGTGATGTTTCTGAGGAAGTTATTAAAGGAGGAGTGAATGAGACGGCCTCAGTTGTTTCAGC
TGGAAAGCATTCCGTTTCTCTTGAGGTTGGGGCTTCTTTGATTAAGTTCATTAGAGGGAAAGAAGGAACTACGCAGATGA
AACTTGAAGAGGAAATGGGAGTGAAGATCATTCTTCCATCATCAAGGAACGAAGATCATATCAGCATTGAAGGTGGTTCA
GTGGAATGTGTAACTAAAGCTTCAGAAAGAATAGCGACCATTATCGATGAGGTTGTAAGGAGTCCGAGTCTCGACTACTC
ACACTTTGTATCACTTCCATTAGCCATACACCCTGAGTTAGTGGACAAGCTAGTGAATTTTCAGAACTCTATTCTCGGAA
ACCATAGCATAGCTAGGGATAAGCAAGACGACCAAGCTAATAGAGAAACCACAAGTGTGGCAGTTGATCTAAAAGCTAAT
AGTGAAACAAACAAGGTCAATGTGGATATCAAGAGTATACCAATTGTCAGTTACCCGCCTAAGGCCAAATCAAAGTCATC
TACTTTATTGGACTTGGGAATTGAAAAGTCCATCTTTATTAAGCCAAGTACTTTCCACTTGACTGTGGTTATGCTTAAGT
TATGGAACAAAGATCGTGTCAATGCAGCGGGTGATGTTCTGAAGAGTATATCTCCTAGTGTGATGGATGCTTTGGATAAG
AAACCAGTATTCATTAGACTTAAGGGCTTGGATTGTATGAGAGGACCATTAGCCAAGACTCGTGTGCTCTATGCTCCTGT
TGAAGAAATTGGTGATGAAGGCCGGCTTTTACGTGCTTGTCGTATCCTAATTTTTAAAGTTATTACTGATGCATTTGTGA
AAGCTGGGCTTGTTCTCGAGAAAGATGCAAAGCAAAGCTTGAAGCTGCATGTGACCGTGATGAATGCTAGGCACAGGAAA
AGGAGAAAGAACAATAAGAAGAAGATGGAGACGTTTGATGCAAGAGAGATACACAAACAGTTTGGAAACGAAGACTGGGG
AGAATATCTGATCCGAGAAGCTCATCTCTCACAGCGTTTTGTGTTCGACCAGAACGGTTATTACCGTTGCTGTGCTTCCA
TACCATTTCCAGGAGAACACACAGCCTGA