Details for Lyrate rockcress Locus 16064734

Position : sca5 ( 5`- 17975338 .. 17977088 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064734

Protein [Map View]
MGKLQDRSITTCLFLFFLQASQIHCTSQSHVRNRLYRSKRGIDSSIDTSHLNAIRHLSVSLSLQNISGVNQQEQRERDRI
ENLPGQPSVSFTQYGGYVTVNESAGRSLYYYFVEATKTKESSPLVLWLNGGPGCSSLYGAFQELGPFRIHSDGKTLYTNP
YSWNNVANILFLESPAGTGFSYTNTTTDMENPGDMKAAADNYVFLVKWLERFPEYKGREFYIAGESYAGHYVPQLAQTIL
VHNKNQTFINLRGILIGNPSLGEDEMGGEYEFLASRGFVPKETFLSFKKNCLDVNPSDDTTYCIDTSLKFEDILESMNKY
NILAPMCLNTTLTNQSKECTTVMQFDTCGEHYLEAYFNLHEVQRSMHVTKQPYMWTLCREALGHTYWNKTDYYASMLPIL
KELMKHEQLRVWVFSGDTDAVISVTVTMYALKMMNLTVVTEWLPWFSEGQVGGFTEEYRGNFRFATVRGAGHEVPLFKPK
AALTLFKHFILNSPLPLTP*

DNA
ATGGGAAAACTACAAGACCGGTCTATAACCACTTGTCTCTTCCTTTTCTTTTTGCAGGCATCACAAATCCATTGCACCAG
CCAATCACATGTTCGAAACCGCCTATACCGATCAAAGCGAGGGATTGATTCGTCAATAGACACAAGCCACTTAAATGCGA
TTCGTCACTTAAGCGTGTCTCTTTCGCTCCAAAACATAAGCGGTGTTAACCAACAAGAGCAAAGGGAAAGAGATAGAATC
GAGAATCTTCCCGGACAGCCTTCAGTTAGTTTTACCCAATATGGCGGTTATGTGACCGTGAACGAGTCAGCAGGTCGATC
CTTGTACTATTATTTCGTGGAAGCCACCAAAACCAAAGAGTCGTCACCGCTTGTTCTATGGCTAAACGGAGGACCGGGCT
GCTCCTCTCTGTATGGGGCATTTCAAGAGCTTGGTCCATTCCGCATACATAGCGACGGCAAAACACTCTATACCAATCCT
TATTCATGGAACAACGTGGCGAACATATTATTCTTAGAATCTCCGGCAGGAACGGGATTTTCGTACACGAACACAACAAC
GGATATGGAAAATCCCGGGGACATGAAAGCAGCAGCTGATAACTACGTTTTCTTGGTGAAATGGCTGGAGAGGTTTCCGG
AATATAAAGGAAGAGAATTTTACATCGCTGGTGAGAGTTACGCCGGGCACTATGTTCCACAACTCGCACAAACCATCCTT
GTCCATAACAAGAACCAAACCTTCATCAACCTACGTGGCATTTTGATTGGTAACCCGAGTCTGGGCGAGGACGAAATGGG
CGGTGAGTATGAGTTTTTGGCGAGCCGTGGTTTTGTCCCTAAAGAAACTTTCCTTAGCTTCAAGAAAAACTGCTTAGATG
TTAACCCTTCAGATGATACGACGTATTGCATCGATACGAGTCTGAAATTCGAAGATATATTAGAAAGCATGAACAAATAC
AACATATTGGCTCCTATGTGCCTAAACACCACGTTGACTAACCAATCCAAAGAATGCACAACGGTGATGCAGTTTGATAC
GTGCGGAGAGCACTACCTGGAAGCTTACTTCAACCTGCACGAGGTTCAGCGTTCAATGCACGTCACGAAACAGCCGTACA
TGTGGACACTATGTAGAGAAGCCCTCGGACATACTTATTGGAACAAGACGGATTATTATGCATCGATGCTACCTATTCTC
AAAGAGCTGATGAAACATGAGCAACTTCGAGTTTGGGTGTTCAGTGGAGACACGGATGCGGTGATTTCTGTGACAGTTAC
AATGTACGCACTGAAGATGATGAATCTAACGGTTGTGACGGAATGGCTTCCCTGGTTTAGTGAAGGACAGGTGGGAGGTT
TCACAGAGGAATACAGAGGGAATTTTAGGTTTGCCACAGTGAGAGGAGCTGGTCATGAAGTTCCTCTTTTCAAACCTAAG
GCTGCTCTTACTCTTTTTAAACATTTTATCCTGAACTCTCCTCTCCCTCTTACCCCTTGA