Details for Lyrate rockcress Locus 16064713

Position : sca3 ( 5`- 2430736 .. 2431631 -3` )
Annotation : [B2G] dual specificity protein phosphatase family protein
External links : CoGe
PGDD synteny : 16064713

Protein [Map View]
MEKVVDIFGVGEANSQKLLKGGKDLSEIQQGLFIGSVAEATNKDLLKSSNITHILTVAVALAPPYPDDFVYKVIEVVDRD
ETDLTVYFDECFSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAFLMKKHGLGFSKAMELVRSRRHQAFPNSGFISQLQQFE
KSLQGMH

DNA
ATGGAGAAAGTGGTTGATATCTTCGGAGTCGGAGAAGCTAATTCCCAGAAGCTACTCAAAGGAGGCAAAGATCTCAGCGA
GATCCAACAGGGATTGTTCATAGGATCAGTAGCTGAAGCGACTAACAAGGATTTGCTCAAAAGCTCCAACATCACTCATA
TCTTAACCGTAGCTGTGGCCCTGGCTCCTCCTTATCCTGATGATTTTGTTTATAAAGTCATCGAAGTTGTTGATAGAGAC
GAGACCGATTTGACAGTATATTTCGATGAGTGTTTTAGCTTCATCGACCAAGCTATTCAATCTGGTGGTGGTGTTTTGGT
TCATTGCTTCATGGGAATGTCTAGGAGTGTGACTATAGTGGTGGCTTTTCTGATGAAAAAGCATGGATTGGGATTCTCTA
AAGCTATGGAACTCGTAAGGAGCCGAAGACATCAGGCATTTCCTAATTCCGGTTTCATTTCCCAGCTCCAGCAATTTGAA
AAATCCTTACAAGGTATGCATGA