Details for Lyrate rockcress Locus 16064694

Position : sca3 ( 5`- 4677932 .. 4674515 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064694

Protein [Map View]
MVKETLIPPSSTSMATGTATSSSLSMTLSSTNALSFLSKGWREVWDSADADLQLMRDRANSVKNLASTFDREIENFLNNS
ARSAFPVGSPSASSFSSEIGIMKKLQPKISEFRRVYSAPEISRKVMERWGPARAKLGMDLSAIKKAIVSEMELDERQGVL
EMGRLRRRRNSDRVRFTEFFAEAERDGEGNFGDWEPIRSLKTRFKEFEKRNSLEILSGFKNSEFVEKLKTSFKSIYKETD
EAKDVPPLDVPELLACLVRQSEPFLDQIGVRKDMCDRIVESLCKCKSQHLWRLPSAQASDLIENDNHGVDLDMRIASVLQ
STGHHYDGGFWTDFVKPETSENKRHVAIVTTASLPWMTGTAVNPLFRAAYLAKSAKQSVTLVVPWLCESDQELVYPNNLT
FSSPEEQESYIRKWLEERIGFKADFKISFYPGKFSKERRSIFPAGDTSQFISSKDADIAILEEPEHLNWYHHGKRWTDKF
NHVVGIVHTNYLEYIKREKNGALQAFFVNHVNNWVTRAYCDKVLRLSGATQDLPKSVVCNVHGVNPKFLMIGGKIAEERS
RGEQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSELGSFNLDVYGNGEDAVEVQRAAKKHDLNLNFLKGRDHADDALHKY
KVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVSKVKEAMTKEPLPLTPEQMYNLSWEAA
TQRFMEYSDLDKILNDGDGGRRMRKSRSVPSFNEMVDGGLAFTHYVLTGNDFLRLCTGATPRTKDYDKQHCKDLNLVPPH
VHKPIFGW*

DNA
ATGGTAAAAGAAACTCTAATTCCTCCGTCTTCTACGTCAATGGCGACCGGTACGGCGACGTCTTCGTCTCTTTCAATGAC
GTTGTCATCAACAAACGCGTTATCGTTTTTGTCGAAAGGTTGGAGAGAGGTATGGGATTCAGCGGATGCGGATTTGCAGT
TGATGCGAGACAGAGCTAACTCCGTTAAGAATCTAGCATCGACGTTCGACAGAGAGATCGAGAATTTCCTCAATAATTCG
GCCAGGTCTGCGTTTCCCGTCGGGTCACCATCGGCGTCTTCTTTCTCAAGTGAAATTGGTATCATGAAGAAGCTTCAGCC
GAAGATTTCGGAGTTTCGTAGGGTTTATTCGGCGCCGGAGATTAGTCGTAAGGTTATGGAGAGATGGGGACCAGCGAGAG
CGAAGCTGGGAATGGATCTATCGGCGATTAAGAAGGCGATTGTGTCTGAGATGGAATTGGATGAGCGTCAGGGAGTTTTA
GAGATGGGTAGATTGAGGAGACGGCGTAATAGTGACAGGGTTAGGTTTACGGAGTTTTTCGCGGAGGCTGAGAGAGATGG
AGAAGGTAATTTCGGTGATTGGGAACCGATTAGGTCTTTGAAGACTAGATTTAAAGAGTTTGAGAAACGAAACTCGTTAG
AAATATTGAGTGGATTCAAGAACAGCGAATTTGTGGAGAAGCTCAAAACCAGCTTTAAATCAATTTACAAAGAAACTGAT
GAGGCTAAGGATGTCCCTCCATTGGATGTACCTGAACTTTTGGCCTGTTTGGTTAGACAGTCTGAACCTTTTCTTGATCA
GATTGGTGTTAGAAAGGATATGTGCGACCGAATAGTAGAAAGCCTTTGCAAATGCAAGAGCCAACACCTTTGGCGTCTGC
CATCTGCACAAGCATCCGATTTAATTGAAAATGATAATCATGGAGTTGATTTGGATATGAGGATAGCCAGTGTTCTTCAA
AGCACAGGACACCATTATGATGGTGGCTTTTGGACTGATTTTGTGAAGCCTGAGACATCAGAAAATAAAAGGCATGTGGC
AATTGTTACAACAGCTAGTCTCCCTTGGATGACCGGAACAGCTGTAAATCCACTATTCAGAGCGGCGTATTTGGCAAAAT
CTGCAAAACAGAGTGTTACACTTGTAGTTCCTTGGCTCTGCGAATCTGATCAAGAACTAGTTTATCCAAACAATCTCACC
TTTAGTTCACCTGAAGAACAAGAGAGCTATATACGTAAATGGTTGGAGGAAAGGATTGGTTTCAAGGCTGATTTTAAAAT
CTCTTTTTACCCAGGAAAGTTTTCAAAAGAAAGGCGTAGCATATTTCCTGCTGGTGACACTTCTCAATTTATATCGTCAA
AAGATGCTGACATTGCTATACTTGAAGAACCTGAGCATCTCAACTGGTACCATCACGGCAAGCGTTGGACCGATAAATTC
AACCATGTTGTTGGAATTGTCCACACAAACTACTTAGAGTACATCAAGAGGGAGAAGAATGGTGCTCTTCAAGCATTTTT
TGTGAATCATGTAAACAATTGGGTCACACGAGCATATTGTGACAAGGTTCTTCGTCTCTCTGGGGCAACACAAGATTTAC
CAAAATCTGTTGTATGCAATGTCCACGGTGTCAATCCCAAGTTCCTTATGATTGGGGGGAAAATTGCTGAAGAGAGATCC
CGTGGTGAACAAGCTTTCTCCAAAGGTGCATACTTCTTAGGAAAAATGGTGTGGGCTAAAGGATACAGAGAACTAATAGA
TCTGATGGCTAAGCACAAAAGCGAACTCGGGAGCTTCAATCTAGATGTCTATGGGAACGGTGAAGATGCAGTCGAAGTCC
AACGTGCAGCAAAGAAACATGACTTAAATCTCAATTTCCTCAAAGGAAGGGACCACGCCGACGATGCTCTTCACAAGTAC
AAAGTGTTCATAAACCCCAGCATCAGCGATGTTCTATGCACAGCAACCGCAGAAGCACTAGCCATGGGGAAGTTTGTGGT
GTGTGCAGATCATCCTTCAAACGAATTCTTCAGATCATTCCCGAACTGCTTAACTTACAAAACATCCGAAGACTTTGTGT
CGAAAGTGAAAGAAGCAATGACGAAGGAGCCATTACCTCTCACTCCAGAGCAAATGTACAATCTCTCTTGGGAAGCAGCA
ACACAGAGGTTCATGGAGTATTCAGATCTCGATAAGATCTTAAATGATGGAGATGGAGGAAGGAGGATGCGAAAATCAAG
ATCGGTTCCGAGCTTTAACGAGATGGTCGATGGAGGGTTAGCATTCACACACTATGTTCTAACAGGGAACGATTTCTTGA
GACTATGCACAGGAGCAACACCAAGAACAAAAGATTATGATAAGCAACATTGCAAGGATCTGAATCTTGTTCCGCCTCAC
GTTCACAAGCCAATCTTTGGCTGGTAG