Details for Lyrate rockcress Locus 16064671

Position : sca3 ( 5`- 5074168 .. 5073130 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064671

Protein [Map View]
MLKHCFVSYNANDLYFSFSNSKFNLSSCPKKPPRLTSCVVNVGFQDIAEVIHNKVLIAAGTSAAIGQLSKPFTSVVLYGK
NLDFRSVFQAGGFPSTHSSSVVAAATAIAFERGFADSIFGLTVVYAGLIMYDAQGVRREVGKHAKVLNKLTANARRSEVM
SFKGNESNKALQSDEISEEVAPPLKESIGHTEVEVIAGALFGFLVTFSVYSLM*

DNA
ATGTTGAAGCACTGTTTTGTGTCTTATAACGCCAATGATCTCTATTTCTCCTTCTCCAACTCCAAATTCAATCTTTCAAG
CTGCCCAAAGAAGCCACCTCGTCTCACTTCGTGCGTTGTCAATGTTGGATTCCAAGATATCGCCGAGGTCATCCACAACA
AGGTACTCATAGCTGCTGGGACTTCTGCTGCGATTGGGCAGCTCTCAAAGCCATTCACTTCTGTGGTTTTGTATGGGAAA
AATCTGGACTTTAGAAGTGTCTTTCAAGCTGGAGGTTTCCCTTCAACACATTCTTCCTCAGTTGTGGCCGCAGCAACTGC
AATTGCTTTTGAAAGGGGATTTGCTGACTCCATTTTTGGTCTTACTGTGGTTTATGCTGGCCTTATCATGTATGATGCCC
AGGGGGTGAGGAGAGAAGTTGGGAAACATGCGAAAGTGTTGAACAAACTAACAGCTAATGCTCGTAGAAGTGAAGTAATG
AGTTTTAAGGGCAACGAATCTAATAAGGCATTGCAATCAGACGAGATCAGTGAAGAGGTTGCTCCTCCATTGAAAGAATC
AATAGGACACACTGAAGTTGAAGTCATAGCAGGGGCTTTGTTCGGTTTCTTAGTTACCTTCAGTGTTTATTCCCTTATGT
AA