Details for Lyrate rockcress Locus 16064632

Position : sca3 ( 5`- 3005645 .. 3008191 -3` )
Annotation : [B2G] gpi transamidase component gpi16 subunit family protein
External links : CoGe
PGDD synteny : 16064632

Protein [Map View]
MASLLRSLILLLIVQSFLFAIAFGSNEVEEFSEALLLKPLPDRKVLAHFHFENRAPPSNSHGRHHHLFPKAISQLVQKFR
VKEMELSFTQGRWNHEHWGGFDPLSSMNAKPVGVELWAVFDVPQSQVDTSWKNLTHALSGLFCASINFLESSTSYAAPTW
GFGPNSDKLRYGSLPREAVCTENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSTVESGQEGLASGIVLEQTL
TVVLQPETTSVESNMQPSWSISSLFGRKVVGRCVLAKSSNVYLQLEGLLGHELKNVDTEIEAHELWKNAEFELSLKPERV
LRESSSFLFIFDIDKSSDSEPFDLGLTWKLPSKWSCQQAPLHASRFLMGSGNERGAIAILLKATESQEKLSGRDLTNGHC
TIKANIFQIFPWYIKVYYHSLQIFVDQQQTTDSEVLKKINVSPSTDKVSSGMMEMMLELPCEVKSVAISIEYDKGFLHID
EYPPDANQGFDIPSALISFPNHHASLDFQEELSKSPLLSSFKEKSLVRSYTEVLLVPLTTPDFSMPYNVITITCTIFALY
FGSLLNVLRRRIGEEERFLKSQGKKTGGRLKQLLSRITAKIRGRPNEEQSSSESPAAQSSVLSSKLIFKIILVAGAAAAW
QYFSTDK*

DNA
ATGGCTAGCCTTCTTCGATCCTTAATCCTTTTGTTAATTGTGCAATCGTTTTTGTTTGCGATCGCTTTTGGGTCGAACGA
AGTTGAAGAATTCAGCGAGGCATTGCTCTTGAAGCCTTTGCCTGATCGAAAGGTTTTAGCTCACTTCCATTTCGAAAACC
GAGCTCCTCCTTCAAATTCCCATGGCCGCCATCACCATCTCTTCCCGAAAGCTATTTCTCAGTTGGTTCAGAAATTCCGG
GTCAAGGAGATGGAGTTATCTTTTACTCAGGGTCGTTGGAATCATGAACATTGGGGAGGATTTGACCCTCTATCAAGTAT
GAACGCAAAGCCTGTTGGGGTGGAGCTTTGGGCTGTGTTTGATGTTCCTCAGTCTCAGGTTGATACTTCTTGGAAGAACT
TAACACACGCACTGTCAGGGCTTTTCTGTGCTTCCATCAACTTTCTTGAATCTTCCACTTCATATGCTGCTCCTACATGG
GGGTTTGGGCCAAATTCGGATAAGCTGAGGTATGGTTCACTGCCACGGGAAGCTGTTTGTACTGAGAACTTGACCCCATG
GCTAAAGTTGCTTCCGTGTAGAGACAAGGATGGCATTTCTGCGTTAATGAATAGGCCATCTGTTTACAGAGGGTTTTATC
ATTCTCAGAGATTGCATTTATCCACGGTTGAGTCTGGTCAAGAGGGATTGGCTTCTGGCATAGTGCTGGAGCAGACTCTT
ACTGTTGTTCTTCAGCCTGAGACTACTTCTGTTGAATCAAATATGCAGCCAAGTTGGTCCATCAGCTCCCTCTTTGGGCG
AAAAGTAGTTGGGAGATGTGTTCTTGCAAAGTCAAGTAATGTGTATCTTCAATTGGAGGGTCTTCTTGGTCACGAATTAA
AGAACGTGGATACAGAAATAGAAGCACACGAACTCTGGAAGAATGCAGAGTTTGAATTATCTCTTAAGCCAGAGAGGGTT
CTTCGAGAAAGCAGCAGCTTTCTTTTTATCTTTGATATTGACAAATCAAGTGACAGCGAGCCATTTGATCTTGGCCTTAC
TTGGAAGCTTCCCTCAAAGTGGTCATGTCAACAAGCTCCATTACACGCAAGTCGGTTTTTGATGGGAAGCGGGAACGAGA
GGGGTGCAATAGCCATCTTGTTAAAAGCGACAGAATCTCAGGAGAAGTTATCAGGCAGAGATCTCACTAATGGCCACTGT
ACAATAAAAGCAAACATTTTCCAGATTTTCCCATGGTATATTAAGGTTTATTATCATAGTCTACAAATCTTTGTTGACCA
ACAACAGACGACAGACAGTGAGGTCTTAAAGAAGATCAATGTCTCCCCATCTACGGATAAGGTGTCATCTGGCATGATGG
AGATGATGCTGGAACTACCATGTGAAGTGAAATCTGTAGCCATATCAATCGAATATGATAAGGGTTTTCTACATATAGAT
GAATATCCTCCTGATGCTAATCAAGGATTCGACATTCCATCGGCTCTGATAAGCTTCCCCAATCATCATGCTAGTTTAGA
TTTCCAAGAAGAGCTCAGCAAATCCCCCTTATTATCAAGTTTTAAGGAAAAATCTTTAGTTCGCTCTTACACAGAAGTAT
TGCTCGTACCATTGACAACCCCAGATTTTAGCATGCCTTACAACGTAATCACGATCACATGCACCATCTTCGCATTGTAT
TTCGGATCATTGCTCAATGTTCTACGTAGACGAATCGGCGAAGAAGAAAGGTTTCTCAAAAGCCAAGGAAAGAAAACAGG
TGGGCGGCTTAAGCAGTTATTATCGAGAATCACAGCCAAGATTAGAGGGAGACCAAATGAAGAACAATCATCGTCAGAGT
CGCCTGCAGCTCAATCTTCGGTCTTGTCTAGTAAACTTATCTTCAAAATCATATTAGTTGCAGGAGCTGCTGCAGCGTGG
CAATATTTTTCCACGGACAAGTAG