Details for Lyrate rockcress Locus 16064590

Position : sca3 ( 5`- 10801042 .. 10799587 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479859 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064590

Protein [Map View]
MEAAKKQSVTNQLLAVKTASGKTFSQLAAETGLTNVYVAQLLRRQAQLKPDTVPKLKEALPALTDELIGDMMSPPWRSYD
PNLIQEPTIYRLNEAVMHFGESIKEIINEDFGDGIMSAIDFYCSVDKIKGVDGNNRVVVTLDGKYLSHSEQRTENMVSRL
NLKGSTSE*

DNA
ATGGAAGCGGCAAAGAAACAGAGTGTTACAAATCAGCTTCTCGCCGTGAAAACAGCTTCCGGCAAGACTTTTAGCCAATT
AGCGGCGGAGACTGGTCTCACCAACGTCTACGTAGCTCAGCTTCTCCGTCGCCAAGCTCAGCTCAAACCGGACACAGTCC
CGAAGCTTAAGGAAGCTTTACCAGCTCTGACCGATGAACTAATCGGAGATATGATGTCTCCGCCGTGGAGATCTTATGAT
CCTAATCTCATTCAAGAACCCACTATCTACAGGTTGAATGAAGCAGTGATGCATTTTGGTGAGAGTATAAAGGAGATTAT
CAATGAAGATTTTGGCGACGGCATCATGTCGGCAATAGACTTCTATTGCTCTGTGGACAAAATCAAAGGAGTGGATGGTA
ATAATCGTGTGGTCGTGACACTTGATGGGAAGTATCTTTCGCATTCCGAACAGAGGACGGAGAATATGGTCTCAAGGCTA
AACCTCAAGGGAAGTACAAGCGAATGA