Details for Lyrate rockcress Locus 16064588

Position : sca3 ( 5`- 4078228 .. 4076723 -3` )
Annotation : [B2G] lycopene cyclase
External links : CoGe
PGDD synteny : 16064588

Protein [Map View]
MDTLLKTPNKLDFFIPQFHGFERLSSNNPNPARVRLGLKKRAIKIGSSVASGSAALLDLVPETKKENLDFELPLYDTSKS
QVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSR
PYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAY
GIIAEVDGHPFDVDKMVFMDWRDRHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMDDIQERMAARLK
HLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLS
AEVWRDLWPIERRRQREFFCFGMDILLKLNLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLFSHASNTSRLE
IMTKGTVPLAKMINNLVQDRD*

DNA
ATGGATACTCTGTTGAAAACACCCAACAAGCTCGATTTTTTCATCCCTCAGTTTCATGGGTTTGAGAGATTAAGCAGTAA
TAATCCAAACCCTGCAAGGGTTAGGCTTGGTCTGAAGAAAAGGGCTATCAAAATTGGCTCTAGTGTTGCCAGTGGTAGTG
CTGCTCTTTTGGATCTTGTTCCTGAAACTAAGAAGGAGAATCTTGACTTCGAGCTTCCTTTGTACGACACTTCCAAGAGT
CAAGTTGTTGATTTGGCTATTGTTGGTGGTGGTCCTGCTGGTTTAGCTGTGGCTCAGCAGGTTTCTGAGGCTGGACTCTC
TGTTTGTTCCATTGATCCTTCTCCAAAGCTCATATGGCCTAACAACTATGGAGTTTGGGTTGATGAGTTTGAGGCTATGG
ATTTACTAGATTGCTTAGACACCACATGGTCTGGTGCTGTTGTCTATGTCGATGAAGGTGTCAAGAAGGATTTAAGCCGG
CCTTATGGGAGAGTTAACCGGAAACAGCTCAAATCCAAAATGCTTCAGAAATGTATTACCAACGGTGTTAAGTTTCATCA
GTCTAAGGTCACTAACGTGGTTCACGAGGAGGCAAACTCCACTGTGGTTTGCAGCGACGGTGTGAAGATTCAGGCTTCGG
TGGTTCTTGATGCCACCGGGTTTTCCCGATGCTTGGTTCAGTATGACAAACCGTACAACCCTGGGTACCAAGTAGCTTAC
GGGATTATAGCTGAAGTCGATGGTCACCCTTTCGATGTAGACAAAATGGTGTTCATGGATTGGAGAGACAGACATCTGGA
CTCATATCCTGAGCTTAAAGAACGGAACAGCAAGATCCCAACATTCTTGTACGCGATGCCGTTTTCTTCCAACCGAATAT
TTCTTGAAGAAACTTCTTTAGTTGCTAGACCTGGTCTGCGTATGGACGATATCCAAGAAAGAATGGCTGCTAGACTGAAA
CATTTGGGGATCAATGTGAAGAGGATTGAGGAAGACGAGCGTTGTGTGATCCCAATGGGCGGTCCTTTACCAGTCTTACC
TCAACGAGTTGTCGGGATTGGTGGGACAGCGGGAATGGTTCATCCCTCAACTGGTTACATGGTAGCTAGGACTCTTGCAG
CTGCGCCAATAGTTGCAAACGCCATTGTGAGATACCTCGGTTCACCGAGTAGTAACAGCCTAAGAGGAGATCAACTCTCT
GCTGAGGTATGGAGAGACTTGTGGCCTATTGAACGGCGCAGACAGAGGGAATTCTTCTGTTTTGGAATGGATATTCTGCT
GAAACTCAACTTAGACGCTACTAGAAGGTTCTTTGATGCATTCTTTGATCTGCAACCTCATTACTGGCACGGATTCTTGT
CTTCCAGGCTGTTTCTCCCGGAACTGTTGTTCTTTGGGTTGTCGCTCTTCTCGCATGCTTCTAATACCTCAAGATTGGAG
ATCATGACAAAGGGGACTGTTCCTCTTGCTAAGATGATCAACAATTTGGTACAAGATAGAGACTAA