Details for Lyrate rockcress Locus 16064545

Position : sca3 ( 5`- 4849921 .. 4854806 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064545

Protein [Map View]
MKEKNSTTASTLGRILATCSKQAKDYGSCVASKVHEVERDICLKEFLALKSCMQHTASVGSGALSHVYIHHPALRCNIPE
SRGLFYDDANRLLICTTSSQVFSWETSPFNPDVPPSVDSINEGPILSIRFSLDKKAIAVQRSDCEVQLFNRETKKILNHK
CKAGSESILGFFWSDSPLCDLAIVKTSGMDLFACDSVLNSLRLVETKKANVNWYTYTHETRLVLLASGLQCKTFNGFQLS
TAGVVRLPRFEMTMARSESNSKPILSAGDLHLVTVYGRIYCLQVDREAMLLHLYRFYRDAVVQQGSLPIYSSTLSVNVVD
NLLLVHQIDAKVVIIYDLFVDSRAPVSAPLPLLWRGYQGSDTSSQAANKEIESSESSTSNENIVMYEDGWTFLVPDLILD
QTNKVLWKIHLDLEAISASSSDRTSLLEFLQRRKLEANKAKQLCLGIARDIILERRPATQVTQAIDVLVTAYSYSVKAGT
YKEIKNEKATASTPTAGASPDNERHRPSGSNIDEDVEMNLSSGSKENMFCANEQQESQLSSPAISPDELYKFVFASVEEM
MVEESEYLVAIITEFLRSISAEKLKVDLNIYVMTIRLLAYSKRFAELSLFTTNKIIEPSKEVAFQLLESGRQNQNIRVRK
LGLDMLRQLSLHHDYISCLVQDGYYLEALRYAQKHKVTTVRSSLFLEAAFASNDMQHLAAILRVLSELIPGFKETSEYYT
FYGLLNDTSSSVGV*

DNA
ATGAAAGAAAAGAATTCCACCACCGCCTCTACACTTGGACGGATTTTAGCTACTTGTTCTAAGCAGGCCAAAGACTACGG
AAGCTGTGTTGCATCTAAAGTCCATGAGGTTGAAAGAGACATATGTTTGAAAGAGTTTCTTGCACTGAAGAGTTGTATGC
AGCATACGGCAAGTGTTGGTTCTGGTGCTTTATCACATGTGTATATACATCATCCAGCCCTACGTTGCAATATTCCTGAA
TCCAGGGGGTTGTTCTATGATGATGCCAACAGATTGCTGATATGTACCACATCTAGTCAGGTCTTTTCATGGGAAACATC
CCCCTTTAATCCAGACGTACCTCCTTCAGTTGATTCTATAAATGAAGGGCCTATTCTGTCAATCAGATTTTCTCTTGATA
AAAAAGCGATAGCTGTCCAAAGATCTGATTGTGAAGTACAGTTGTTTAATCGAGAGACCAAGAAGATACTAAACCACAAA
TGTAAGGCAGGATCAGAGAGCATTCTCGGATTCTTTTGGAGTGACTCTCCATTATGTGATCTTGCAATTGTAAAGACCAG
TGGCATGGACTTGTTCGCTTGTGATTCTGTGTTGAATTCACTACGTTTGGTGGAAACCAAAAAGGCGAATGTGAATTGGT
ACACCTATACACATGAAACTCGATTGGTTCTTCTTGCATCAGGATTGCAATGCAAGACATTTAATGGATTTCAGCTTTCC
ACTGCAGGAGTTGTTCGTTTACCAAGATTTGAGATGACCATGGCTAGATCTGAATCAAACAGTAAACCTATTCTCTCTGC
TGGAGATCTCCACTTAGTCACTGTCTATGGCCGAATATATTGCTTACAAGTGGACAGGGAGGCAATGCTACTGCATCTAT
ACAGGTTTTACCGAGATGCAGTTGTTCAACAAGGTTCTTTACCAATATACTCAAGCACATTGTCGGTGAATGTGGTCGAT
AATTTATTGCTTGTGCACCAAATCGATGCAAAGGTTGTCATCATCTACGACTTATTTGTGGATTCTCGAGCTCCTGTATC
TGCGCCTCTTCCTTTGCTGTGGAGGGGTTACCAAGGCTCTGACACATCGTCTCAAGCTGCTAACAAAGAAATTGAGAGCT
CAGAATCATCTACAAGCAATGAAAACATTGTCATGTATGAAGATGGCTGGACCTTTCTTGTTCCAGATCTTATTCTGGAT
CAGACTAACAAGGTTTTATGGAAGATACATTTGGATCTTGAGGCAATTTCCGCTAGCAGCTCAGACAGGACGTCTCTTCT
AGAATTCCTGCAGCGAAGGAAGTTGGAAGCAAATAAGGCCAAACAATTGTGCTTGGGGATAGCAAGGGATATTATTTTGG
AACGTCGACCAGCAACCCAGGTAACTCAGGCAATCGATGTACTAGTCACAGCATATTCGTACTCGGTTAAAGCCGGTACA
TACAAGGAAATAAAAAACGAAAAGGCCACTGCATCTACTCCAACCGCTGGTGCATCTCCTGATAACGAAAGACATAGGCC
GTCTGGAAGCAATATTGATGAAGATGTTGAAATGAACCTATCATCTGGTTCAAAGGAGAACATGTTTTGTGCTAATGAGC
AGCAAGAATCTCAACTTTCTTCACCGGCAATTTCACCCGATGAGCTCTACAAGTTTGTATTTGCTTCTGTTGAGGAAATG
ATGGTTGAGGAATCAGAGTACCTAGTTGCTATCATCACCGAGTTCCTTCGCAGTATAAGTGCAGAAAAACTCAAAGTGGA
TTTGAATATCTATGTGATGACCATCAGACTTTTAGCTTACAGTAAGCGATTTGCAGAACTGTCGCTATTCACCACAAACA
AGATAATCGAACCATCAAAGGAAGTTGCCTTCCAACTTCTCGAGAGTGGTCGCCAAAACCAAAATATCCGGGTAAGGAAA
CTTGGGCTTGATATGTTGAGACAACTCTCCTTGCACCATGATTACATCTCTTGCCTTGTGCAAGATGGATACTATCTTGA
AGCTCTGCGATATGCTCAGAAGCATAAGGTGACGACTGTGCGATCGTCGCTGTTCCTAGAAGCAGCATTCGCGTCGAATG
ATATGCAGCATTTGGCTGCAATTTTGAGGGTCTTGTCGGAATTGATTCCTGGGTTTAAAGAAACTTCCGAATATTACACT
TTTTATGGCCTTCTCAATGACACCAGTTCCTCAGTTGGTGTCTGA