Details for Lyrate rockcress Locus 16064516

Position : sca3 ( 5`- 9474823 .. 9475024 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064516

Protein [Map View]
MHVRSTDRVMKFKAKIVFGGRQVYLHYYMQIDEFLKSKCLFVTLTIACTLSFLCNSLLFLRRNIRMC

DNA
ATGCATGTACGTAGCACCGATCGGGTGATGAAGTTCAAAGCAAAAATTGTATTTGGAGGCCGCCAAGTGTATTTACACTA
TTACATGCAGATTGATGAGTTCTTGAAGTCCAAGTGTCTCTTTGTCACTCTCACTATTGCATGCACATTGTCATTTTTGT
GTAATAGTCTCCTCTTTTTGAGGCGCAATATTCGCATGTGTT