Details for Lyrate rockcress Locus 16064515

Position : sca3 ( 5`- 3651524 .. 3650137 -3` )
Annotation : [B2G] PTAC13 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064515

Protein [Map View]
MMKLQGGLLQWSRSSLIPSIYTPINKTQFSISACVIERNHQLTAKERRQLRNERRESKSGYSWREEVEEKLIKKPKKRYA
TWTEELNLDTLAESGPQWWVVRVSRLRGHETAQILARALARQFPEMEFTVYAPSVQVKRKLKNGSISVKPKPVFPGCIFI
RCILNKEIHDSIREVDGVGGFIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEAQEKADSEFEEAQSAEEEEASLLASQQ
LLASSNSEVIEAVAESKPKRAPRKATLATETKDSKAKKKKLAAGSTVRVLSGTFAEFVGNLKKLNRKTAKATVGFTLFGK
ETLVEIDINELVPEIQS*

DNA
ATGATGAAGCTGCAAGGGGGACTTCTCCAATGGAGTCGTAGCAGCTTAATCCCGTCGATTTACACACCGATCAACAAAAC
CCAATTCTCTATCTCCGCCTGTGTTATCGAACGGAATCACCAGCTGACGGCGAAGGAGAGACGGCAGCTCCGGAACGAGC
GGCGGGAGAGCAAATCGGGGTATAGCTGGCGAGAAGAAGTTGAAGAAAAGTTGATTAAGAAACCAAAGAAACGGTATGCG
ACGTGGACGGAGGAGCTGAATTTGGATACTTTGGCTGAGTCCGGTCCGCAATGGTGGGTGGTTAGGGTTTCGAGACTTCG
TGGTCATGAGACTGCTCAAATCTTAGCTCGAGCTCTGGCTCGTCAATTCCCTGAAATGGAATTCACGGTTTATGCTCCAT
CTGTTCAAGTGAAGAGAAAGCTAAAGAACGGTTCTATATCTGTTAAACCGAAACCAGTGTTCCCTGGTTGCATTTTCATC
AGATGTATATTGAACAAAGAGATACATGACTCCATAAGAGAAGTTGATGGAGTCGGAGGTTTCATAGGTTCAAAAGTTGG
AAATACCAAGAGACAGATTAATAAACCAAGACCTGTAGACGACAGTGACTTGGAAGCTATTTTCAAACAAGCAAAAGAAG
CGCAAGAGAAGGCAGACAGTGAGTTCGAAGAAGCACAAAGTGCTGAAGAAGAAGAAGCGAGTTTACTAGCATCACAGCAA
CTTCTCGCATCATCTAATTCAGAAGTTATTGAGGCTGTAGCAGAATCTAAACCGAAACGAGCCCCGAGAAAGGCTACACT
TGCTACTGAAACAAAGGATTCAAAGGCGAAGAAGAAGAAACTCGCAGCGGGTTCTACAGTTCGAGTGTTATCAGGGACAT
TCGCTGAATTTGTCGGCAACCTAAAGAAACTAAACCGCAAAACTGCAAAGGCAACGGTGGGATTTACTTTGTTTGGGAAG
GAGACACTAGTGGAAATTGACATCAATGAACTTGTTCCTGAGATTCAATCTTAA