Details for Lyrate rockcress Locus 16064477

Position : sca3 ( 5`- 6269087 .. 6270905 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064477

Protein [Map View]
MATHTISRSILCRPAKSLSLLFTRSFASSAPLVKIPASSLLSRSRPLVAAFSSVFRGGLVSVKGLSTQATSSSLNDPNPN
WSNRPPKETILLDGCDFEHWLVVVNPPEGDPTRDDIIDSYIKTLAQIVGSEDEARMKIYSVSTRCYYAFGALVSEDLSHK
LKELPNVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYDPKYHEEWIRNNARANERNRRNDRPRNFDRTRNFERRRENMAGG
PPPQRPPMGGPPPPPHMGGSAPPPPHMGGSAPPPPHMGQNYGGPPPPNNMGGQRPPPNYGGPPQNNMGGQRPPPNYGGAP
PPNYGGAPPANNMGGGPPPNYGGVPPPNYGAAPPPNYGGAPPQNNNYQQQSGGMQQPQYQNNYPPNRDGSGNPYQG*

DNA
ATGGCGACGCATACCATTTCTCGCTCCATTCTTTGCCGACCGGCGAAATCTCTTTCCCTTCTGTTCACGCGATCTTTTGC
TTCATCTGCTCCTCTCGTCAAAATTCCGGCGTCGTCTCTGCTCAGCCGTTCCCGTCCTCTCGTCGCCGCTTTTTCCTCCG
TTTTCCGTGGCGGCCTTGTGTCTGTTAAAGGTCTCTCAACGCAGGCTACGTCGTCTTCTCTGAACGATCCGAACCCCAAC
TGGTCGAACAGGCCACCTAAGGAGACGATCCTGCTCGATGGATGCGATTTCGAGCACTGGCTTGTCGTCGTGAATCCACC
GGAGGGTGATCCTACTAGAGACGATATCATTGATAGTTACATCAAAACCCTAGCTCAGATTGTTGGCAGTGAAGACGAAG
CTAGGATGAAGATCTACTCGGTTTCAACTAGGTGCTACTATGCTTTTGGAGCCCTTGTGTCAGAAGATCTTTCTCACAAG
TTAAAAGAGTTGCCAAATGTGCGCTGGGTTCTTCCTGACTCTTACCTGGATGTGAGGAACAAAGACTACGGAGGGGAACC
TTTCATCGATGGCAAGGCTGTTCCTTATGATCCCAAGTACCACGAGGAGTGGATAAGGAACAATGCTAGAGCAAATGAAA
GAAACAGACGCAATGATCGTCCTCGCAACTTTGATAGAACCAGAAACTTTGAGAGGAGAAGAGAGAACATGGCAGGAGGC
CCTCCTCCTCAACGTCCTCCAATGGGAGGTCCTCCTCCTCCTCCGCACATGGGTGGCTCTGCACCTCCTCCGCCTCACAT
GGGTGGCTCTGCACCTCCTCCACCTCACATGGGGCAGAACTACGGTGGACCACCACCACCAAACAACATGGGAGGACAAA
GGCCGCCACCCAACTATGGAGGACCACCGCAAAACAACATGGGAGGACAGAGGCCACCACCAAACTACGGAGGAGCACCA
CCTCCGAACTACGGAGGAGCCCCACCAGCAAACAACATGGGAGGAGGACCACCACCTAACTATGGAGGAGTACCACCACC
AAACTATGGAGCAGCACCGCCACCTAACTACGGAGGAGCACCCCCACAGAACAACAACTACCAGCAGCAGAGTGGTGGAA
TGCAGCAGCCACAGTACCAGAACAACTACCCACCTAACCGGGATGGCAGCGGTAACCCCTATCAGGGTTAA