Details for Lyrate rockcress Locus 16064471

Position : sca3 ( 5`- 1313084 .. 1311334 -3` )
Annotation : [B2G] binding protein
External links : CoGe
PGDD synteny : 16064471

Protein [Map View]
MGRNLGSAFRQELANLDKDPDSHKAAMRNLRSIVKDLDANVIHVFVSQLSEVKEIGSESGGYTVSLFEDLARAHGVQIAP
HVDIIMSAIIRTLSSSEGSLRIQQACSKAVAAMARYGIDPTTPEDKKMNVVHSLCKPLSDSLIDSQHQQHLALGSALCLK
SLVDCDNWRSASREMVNNVCQSLAVALEATSSEAKSHMALVMALSKHNPFTVEAYARLFVKSGLRILDLGVVEGDSQKRL
LAIQMLNFLMKNLNPKSICSELELIYQEMEKHQKDQMHYVKMAAHETMRQAERLIGEADPMFDAENCKPQISFSGSIKST
PSLRADDESVYRRGDGSYVNDQDEYDALFSGVASGRTLVSGSPLVTFGDNNQETDVVIESPRIGDQIQCSGVEDDKIESV
WFHQRNRSSEFNESVCSRTNRSRSSRRNTKKRQSGDICSKHHRHGFTQDPFTELLDNRQQLQQYSESSSSSSIYDTSGTT
TPTNTTEDICEKPKSDLDSKAELKTGETEIDPRHGQSKRVLKLGLCVFSIAVAGFASFMWMHLQDDMMLPHLVPT*

DNA
ATGGGGAGAAATCTTGGTTCGGCATTTAGACAAGAGTTGGCTAATCTTGACAAAGATCCTGATTCCCACAAGGCTGCAAT
GAGAAATTTGAGATCGATTGTTAAAGATTTGGATGCAAATGTGATTCATGTGTTTGTTTCTCAGCTTTCTGAAGTCAAAG
AGATTGGTTCTGAGTCTGGTGGTTACACAGTTTCTCTCTTTGAAGACCTTGCTCGTGCTCATGGAGTTCAAATTGCTCCT
CACGTAGACATTATCATGTCGGCGATCATAAGGACATTGAGTTCCAGTGAAGGGTCTCTACGTATTCAACAGGCTTGCTC
AAAGGCGGTAGCTGCTATGGCTAGATATGGAATTGATCCTACAACACCGGAAGATAAGAAAATGAATGTGGTTCATTCTC
TTTGTAAGCCACTCTCTGATTCTCTTATAGATTCGCAACATCAACAGCATCTTGCTTTGGGATCTGCTCTTTGCTTGAAG
TCACTTGTGGATTGCGATAATTGGCGATCTGCTTCTCGTGAAATGGTTAATAATGTTTGTCAAAGCTTAGCTGTTGCTCT
TGAAGCCACTTCAAGTGAAGCTAAGTCTCATATGGCACTTGTCATGGCACTTTCCAAGCACAACCCTTTTACTGTCGAAG
CATATGCAAGGCTTTTTGTGAAGTCGGGTCTGAGGATTCTGGATTTAGGTGTTGTTGAGGGAGATTCTCAGAAACGGCTT
TTAGCTATACAGATGCTCAACTTTCTGATGAAGAATCTGAATCCCAAGAGTATTTGTTCTGAGTTAGAGCTTATATATCA
AGAGATGGAGAAACACCAAAAAGATCAGATGCATTATGTCAAAATGGCAGCTCATGAAACCATGAGACAAGCAGAGAGAT
TAATAGGTGAGGCAGATCCAATGTTTGACGCAGAGAACTGCAAGCCCCAAATCTCGTTCAGCGGATCAATCAAGTCTACA
CCAAGTCTGCGAGCAGATGATGAGAGTGTTTATAGGAGAGGTGATGGGAGTTATGTAAATGATCAAGACGAGTATGATGC
TTTGTTTTCTGGTGTAGCCAGTGGAAGAACTCTTGTCTCAGGCTCTCCTCTGGTGACTTTCGGAGACAATAACCAAGAAA
CTGATGTTGTGATCGAGAGTCCAAGAATTGGAGATCAGATTCAATGTTCTGGTGTTGAAGATGACAAGATTGAGTCAGTT
TGGTTCCATCAGCGGAACAGAAGCTCCGAGTTTAATGAATCTGTGTGCTCTAGGACCAACCGCTCAAGAAGTTCAAGACG
AAACACCAAGAAGAGACAATCAGGTGACATCTGTTCAAAACACCACAGGCATGGTTTCACACAGGATCCATTCACTGAGT
TACTAGATAACAGACAGCAGCTGCAACAGTACAGTGAAAGCTCATCATCATCATCAATATATGATACCTCTGGTACTACT
ACTCCAACCAACACAACAGAAGATATCTGTGAGAAACCAAAGTCAGATTTGGATTCTAAGGCCGAACTTAAGACAGGGGA
GACTGAAATAGACCCACGTCATGGACAGAGCAAGCGTGTGTTAAAATTGGGATTGTGTGTCTTCTCTATTGCAGTTGCAG
GGTTTGCTTCTTTCATGTGGATGCATCTCCAGGATGATATGATGCTTCCTCACCTTGTTCCGACTTAA