Details for Lyrate rockcress Locus 16064455

Position : sca3 ( 5`- 7105558 .. 7106727 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064455

Protein [Map View]
MTKISDLPRDLTEEVLSRLPVTSMRAVRFTCKNWNSLSKDRSFRKKHLRGAISAAKKKQTKEFQVIMMIQYRVYLFSVNL
LNPSIERIGKLISLDVEDRVDISKIFHCHGLLLCITKDISRLVVWNPYSGQTRWIQPRNSYHRLDRYALGYEEKKNSCRS
YKILRFMDNYEGDNPPYLIREFEIYDLNSDSWKVVDVPPDWEIEYYHRGLSLKGNTYWFAQEKLPIFPLGRVVSDMADFL
LCFDFTRERFGPRLPLPFHSFVEDTVTLSSVRDKQLAVLFQPCYASTVKIWISSKIEPNAVSWRKVFLAVDMKPLTGFQF
DINAGSFFVDQKKKVAMVLDKDRFRSKLTRNIAYIIGKKGYFKKVDLGESTVPSCASLVCSYVPSSTQI*

DNA
ATGACTAAGATTTCGGATCTTCCACGGGATTTGACAGAGGAGGTGCTCTCTAGGCTTCCGGTGACATCTATGAGAGCAGT
GCGATTTACTTGCAAAAATTGGAATAGTTTATCGAAAGATCGGAGCTTTAGAAAGAAGCACCTGCGTGGAGCAATATCAG
CAGCGAAGAAGAAGCAGACGAAGGAGTTTCAGGTGATCATGATGATTCAATATAGGGTTTATTTATTCAGCGTCAATCTC
CTCAATCCATCTATAGAGCGTATAGGTAAACTTATTAGCCTAGACGTTGAAGATCGTGTCGATATATCTAAAATCTTTCA
CTGCCACGGTTTATTGTTATGCATCACCAAAGACATATCTAGGCTTGTGGTTTGGAACCCTTACTCTGGGCAAACTAGGT
GGATCCAACCTAGAAATTCTTACCACAGATTGGACAGGTACGCTTTAGGATATGAAGAGAAGAAAAATTCGTGTCGTAGC
TACAAAATCTTGAGATTTATGGATAATTACGAGGGCGACAACCCACCGTACCTAATTCGTGAGTTTGAAATCTACGACTT
AAACTCTGATTCATGGAAGGTTGTTGATGTCCCTCCTGACTGGGAAATAGAGTATTATCACCGTGGCTTGTCTCTCAAGG
GGAATACTTACTGGTTTGCTCAAGAGAAGCTTCCAATATTCCCACTCGGAAGAGTGGTATCAGATATGGCTGATTTCTTA
CTCTGTTTTGATTTTACAAGGGAGAGGTTTGGACCGCGTCTGCCTCTGCCTTTTCACTCTTTTGTTGAAGATACTGTGAC
TCTATCTAGTGTTAGAGATAAGCAACTTGCAGTGTTATTTCAGCCATGTTATGCATCTACCGTGAAGATATGGATTAGTA
GCAAGATTGAGCCCAATGCAGTGTCGTGGAGGAAGGTTTTCTTAGCGGTTGATATGAAACCACTCACTGGTTTTCAGTTT
GACATTAACGCTGGGAGTTTCTTTGTTGACCAGAAGAAAAAGGTCGCCATGGTTCTTGATAAAGATAGATTCAGATCTAA
ATTAACTCGCAACATAGCTTACATCATTGGAAAGAAGGGGTATTTCAAAAAGGTGGATCTTGGAGAATCTACAGTGCCAT
CTTGTGCCTCACTTGTGTGCTCTTACGTTCCAAGCTCAACGCAAATCTAG