Details for Lyrate rockcress Locus 16064325

Position : sca1 ( 5`- 7768025 .. 7769571 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_472069 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064325

Protein [Map View]
MLSRLFKAGEKVLLNLVSKKDLHMASRNQEKSPKVQELYDLCKETFTGKAPSPASMAVQKLCSVLDSVSPADVGLEEVSQ
DDDRGYGVSGVSRFNRVGRWAQPITFLDIHECDTFTMCIFCFPTSSVIPLHDHPEMAVFSKILYGSLHVKAYDWVEPPCI
ITQDKGVPGSLPARLAKLVGDKVLTPQSEIPVLYPKTGGNLHCFTALTPCAVLDILTPPYKESVGRSCSYYMDYPFSTFA
LEEGMKKVEGKEDEYAWLVQIDTPDDLHMRPGSYTGPTIRV*

DNA
ATGTTGTCGAGATTGTTCAAGGCAGGTGAAAAGGTTTTGTTGAATCTCGTTAGCAAGAAAGACCTTCACATGGCGTCGAG
GAATCAGGAGAAATCTCCCAAAGTGCAAGAGCTTTACGACCTCTGCAAAGAGACTTTCACTGGCAAAGCTCCTTCTCCTG
CTTCCATGGCTGTCCAAAAACTATGCTCTGTGTTGGACTCAGTTAGTCCTGCAGATGTTGGGCTTGAAGAGGTATCTCAA
GACGACGATCGAGGCTACGGAGTTTCTGGGGTTAGCCGTTTCAACAGAGTAGGACGATGGGCACAACCGATAACATTCTT
AGACATTCACGAATGTGATACTTTTACAATGTGTATTTTCTGCTTCCCAACATCTTCAGTGATTCCATTGCATGACCATC
CAGAGATGGCTGTGTTTAGCAAAATCCTCTATGGATCACTTCATGTTAAAGCTTACGATTGGGTTGAACCTCCATGTATT
ATCACACAAGATAAAGGCGTGCCCGGTTCTCTTCCAGCAAGGTTGGCCAAATTGGTGGGTGACAAAGTTCTTACGCCTCA
GTCTGAGATACCGGTGTTGTACCCAAAGACTGGAGGCAATCTCCATTGCTTCACTGCACTGACTCCATGTGCGGTGCTTG
ACATCCTCACACCTCCTTACAAAGAAAGTGTTGGCAGGAGTTGCAGTTATTACATGGACTATCCGTTTTCCACTTTCGCA
TTGGAGGAAGGAATGAAGAAGGTGGAAGGAAAGGAAGACGAATACGCTTGGCTTGTACAGATTGACACACCCGATGATCT
TCACATGCGTCCCGGATCATATACTGGTCCAACTATCAGGGTCTAG