Details for Lyrate rockcress Locus 16064190

Position : sca3 ( 5`- 4304546 .. 4302571 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064190

Protein [Map View]
MSASTVSITASPTRAIRRTPVLSGENKSNFDFPPSESHANAAIGESSAGTNKDLIRSEAAAERSNTYDVGPVTRKSGSTA
TGTNTTTTQRRTRKSQGNKTDKGQWKTVVRVFAKQFGALLLLVGLIQLIRKLTLKDSSLSSSNFPIETEMVLSELESRIS
AVDGLVKTTTKMMQVQVEFLDKKMESESRALRQTIDSTSSVLQSGLKKVESKTERLQVSVDELNAKPLVSREELERVYEE
LKKGKVGDSDVNIDELRAYARDVVEKEIGKHAADGLGRVDYALASGGAFVMGHSDPFLVGSGGNWFGTSRRRVHSKAVKM
LTPSFGEPGQCFPLKGSNGYVLVRLRAPIIPEAVTLEHVSEAVAYDRSSAPKDCRVSGWLGDIDMETETMPILTEFSYDL
DRSNAQTFDIAESAHSGLVNTVRLDFNSNHGSSSHTCIYRFRVHGCQLDSVSVVHA*

DNA
ATGTCGGCATCAACGGTGTCAATCACCGCTAGTCCTACGAGGGCAATTAGGCGGACGCCGGTTCTCTCCGGTGAGAATAA
ATCCAATTTTGATTTCCCGCCGAGCGAATCTCATGCCAATGCGGCAATTGGAGAGTCTTCCGCTGGTACGAACAAGGATC
TGATTCGCTCCGAGGCTGCCGCTGAGAGATCTAACACCTACGACGTCGGTCCTGTGACTAGGAAATCGGGATCCACCGCG
ACGGGGACTAATACAACCACCACGCAGCGTCGAACGCGGAAGTCTCAGGGGAATAAGACAGATAAGGGGCAGTGGAAGAC
AGTGGTTAGGGTATTCGCGAAGCAATTTGGGGCTCTTTTGTTACTTGTTGGGTTGATTCAATTGATTAGGAAATTGACTT
TGAAGGATTCGTCTCTATCTTCTTCTAATTTCCCAATTGAAACGGAAATGGTGCTTTCGGAATTGGAGAGTCGGATTTCG
GCTGTTGATGGTTTGGTAAAGACTACTACGAAGATGATGCAGGTTCAAGTTGAATTTCTTGATAAGAAGATGGAAAGCGA
ATCAAGAGCATTGAGGCAGACGATAGATTCCACATCTTCTGTGTTGCAGAGTGGGTTGAAGAAGGTAGAGTCTAAGACGG
AGAGATTGCAGGTTTCCGTAGATGAGTTAAATGCTAAACCTTTGGTGTCTAGAGAGGAATTAGAGAGAGTTTACGAGGAG
TTGAAGAAGGGTAAGGTCGGTGATTCTGATGTTAACATTGATGAATTGAGGGCTTATGCTCGTGACGTAGTGGAGAAAGA
GATTGGAAAGCATGCTGCTGATGGCCTTGGCCGAGTAGACTATGCGTTAGCGTCTGGTGGGGCTTTTGTAATGGGGCATT
CGGATCCGTTTCTTGTTGGAAGTGGGGGTAATTGGTTTGGGACAAGCAGGCGGCGGGTTCATAGCAAAGCGGTTAAGATG
TTAACTCCGAGTTTCGGGGAGCCTGGACAGTGTTTTCCTCTGAAAGGAAGCAATGGCTATGTTCTAGTCAGGCTAAGAGC
ACCAATAATTCCAGAGGCCGTTACCTTGGAGCATGTCTCTGAGGCTGTAGCGTATGACAGATCGAGCGCCCCAAAGGATT
GCCGGGTATCAGGATGGCTAGGTGACATAGATATGGAGACTGAAACCATGCCCATTCTTACAGAATTCAGTTACGACTTA
GACAGGTCCAATGCACAGACATTCGACATTGCAGAGTCTGCTCATTCGGGACTTGTCAACACTGTCAGGCTAGACTTCAA
TTCCAACCATGGAAGCTCTTCACACACTTGCATCTACCGCTTCAGGGTTCATGGCTGTCAACTAGACTCAGTCTCTGTTG
TTCATGCTTGA