Details for Lyrate rockcress Locus 16064189

Position : sca3 ( 5`- 9294583 .. 9294272 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064189

Protein [Map View]
MASMTMTATFLPAIAKLPSATGGRRLSVVRASTSDNTPSLQVKEQCSTTMRRDLMFTAAAAAVCSLAKVAMAEEEEPKRG
TEAAKKKYAQVCVTMPTAKICRY*

DNA
ATGGCATCGATGACCATGACTGCTACTTTCCTCCCGGCCATCGCCAAGCTTCCCTCAGCCACCGGCGGACGAAGGCTCTC
GGTAGTCAGAGCCTCCACGAGCGACAACACACCCAGCTTACAAGTCAAGGAACAGTGCAGCACCACAATGAGGAGGGACC
TCATGTTCACGGCTGCAGCTGCAGCGGTTTGTTCTTTGGCTAAAGTAGCCATGGCTGAAGAAGAAGAGCCCAAGCGAGGG
ACAGAGGCGGCCAAGAAGAAATACGCACAAGTTTGTGTCACAATGCCTACGGCCAAGATCTGCCGCTACTGA