Details for Lyrate rockcress Locus 16064174

Position : sca3 ( 5`- 10778587 .. 10778316 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064174

Protein [Map View]
GASRKRKETESDPRATAPNWLLAGYMAHEYLTCGTMLGRKLYPGWAEVGPHIEAKKAHQSYSEVATVFKTDGNHVPGVVN
PTQLAKWIQM

DNA
GGCGCGTCAAGAAAACGTAAGGAGACGGAGAGTGATCCAAGAGCAACCGCACCGAACTGGCTACTGGCTGGCTACATGGC
ACACGAGTACCTCACGTGCGGTACTATGTTGGGCCGGAAGTTGTATCCTGGATGGGCCGAAGTTGGGCCGCACATAGAAG
CGAAAAAGGCTCATCAGAGTTACTCTGAAGTGGCGACTGTGTTCAAAACAGATGGGAACCATGTCCCTGGTGTGGTTAAC
CCGACCCAGCTTGCTAAATGGATCCAGATGTG