Details for Lyrate rockcress Locus 16064172

Position : sca3 ( 5`- 12457586 .. 12457356 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064172

Protein [Map View]
MKTFMIILLVICSILIAGRVEANNPKRKYLNPGILNPCLRPNAHKGCQRPQYKPRTPVNSYSRGCSTINRCRRQTP*

DNA
ATGAAGACATTTATGATAATCTTGTTGGTGATTTGTAGCATATTGATTGCAGGACGAGTTGAAGCTAACAATCCCAAGAG
GAAATATTTAAATCCGGGTATTCTCAATCCATGCTTGCGTCCTAATGCTCATAAAGGATGTCAGCGTCCACAATATAAAC
CACGTACTCCGGTAAACTCATATAGTCGTGGCTGCTCCACAATCAACCGATGCCGCCGACAGACTCCATGA