Details for Lyrate rockcress Locus 16064166

Position : sca3 ( 5`- 12023869 .. 12026236 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064166

Protein [Map View]
MPEGKLRSGVYRSFIMCDDPRDVVECGAIKKQSKSRSSSTKQRCEEHLSKAKERSEMAVAPRKSNTEDVPPSSFQLLRVS
KGIQKLNGAIESWSKGFSFEAVSRPEDIAKDLLRGALDLEESLAMLSSIQEDDSKQKPRICKDGRSDLRFQRSMSDRFGE
RVEKRMMVQESVASKDCYEELRKVIRESFLRQNLVSQTTTTGIKTRVVRNDFASSSGAASSSTSSSQSSMVSGSTKSSAS
SDIPRRAPSLIARLMGLDVSTQEPSKSTVNHIDKPDILKLSSERQEKVKKNNKESPEIVRCNSMRETVLQSLPEEIPREN
PSTIVLIRPMRVVQPEMEEKPGSKRPVVPKKPRMQGEVHPRMINQRKDHQAKGSNKMKLPLSLTKKDKEPKEMVRKGEEN
EGKVIKLMSPSNGRTLTRDRKPLETNKTNKKLVVKKEDIAEGKDRHRPHDRALKPPSNPASQKKSNNPSDVSRNKSRRSS
RLSSSSSSGSREKKSGEASRPNAKKKLRQQDNNLGSENHSSSQDTLGSLNQLSTEETTSSEFHNQGQCDNGEVSSCAATI
HYSHEPEASQISLKSFLSSSSEFINYAEDLFDFNTNTKRSRESNFRNRDNIVISDQRLALDFAKEVARRKSLLLAEQPCH
TRSSLHIDEVLMEVCDGFESLGSYKDTFSGQNSFVKETIHLVLEKDLKGKKTEMTSGVWDLGWRSEFQIDETYQAVVVDL
EKLILSSLIQEIIS*

DNA
ATGCCTGAAGGGAAATTGAGATCAGGAGTTTATAGATCATTCATAATGTGTGATGATCCAAGAGATGTTGTTGAATGTGG
AGCTATTAAGAAACAGAGTAAGAGTCGTAGTAGTAGTACTAAACAGAGATGTGAAGAACATCTTTCGAAAGCGAAAGAGC
GGTCTGAAATGGCGGTGGCGCCTAGGAAGAGTAATACCGAGGATGTTCCTCCTTCTTCGTTTCAGCTTTTGAGAGTATCT
AAAGGGATTCAGAAACTGAATGGTGCGATTGAGTCTTGGTCTAAAGGGTTTAGCTTTGAGGCAGTGTCGAGGCCTGAGGA
TATAGCGAAAGATTTGTTAAGAGGAGCACTTGATTTGGAAGAGTCTTTAGCTATGTTAAGTAGTATTCAAGAAGATGATA
GTAAGCAGAAACCGAGGATTTGTAAAGACGGAAGAAGCGATTTGCGGTTTCAAAGATCGATGTCGGATAGATTCGGAGAG
CGGGTTGAGAAACGGATGATGGTTCAAGAGAGTGTAGCATCTAAGGATTGTTATGAAGAGTTAAGGAAAGTGATTAGAGA
GAGCTTTCTTAGGCAGAATCTTGTTTCACAAACAACTACTACAGGGATTAAGACTCGAGTTGTTAGAAATGATTTTGCTT
CTTCTTCTGGAGCTGCATCGTCGTCAACTAGCTCGAGCCAATCTTCTATGGTTTCTGGCTCTACAAAGTCCTCTGCTTCG
TCTGATATTCCACGGAGAGCTCCAAGTTTGATTGCTAGGCTTATGGGTTTGGATGTATCAACTCAAGAACCGAGCAAAAG
CACGGTGAATCATATCGATAAGCCGGATATTTTAAAGCTGTCATCAGAAAGACAAGAGAAGGTGAAGAAGAATAATAAGG
AGAGTCCCGAAATTGTGAGATGCAACTCTATGAGAGAAACTGTTTTACAATCTTTGCCTGAAGAGATTCCGAGAGAGAAT
CCCTCGACTATAGTACTCATCAGACCTATGCGTGTTGTACAACCCGAGATGGAAGAAAAGCCGGGAAGCAAACGACCGGT
TGTACCTAAGAAACCGAGAATGCAAGGGGAGGTTCATCCAAGAATGATTAACCAGAGAAAAGATCATCAAGCCAAGGGAA
GCAACAAAATGAAATTACCATTAAGTCTGACCAAGAAAGACAAAGAACCGAAAGAAATGGTGCGGAAAGGAGAAGAGAAT
GAAGGTAAGGTGATCAAGCTAATGTCTCCAAGCAATGGCAGAACTCTAACAAGAGATCGAAAACCGTTGGAAACCAACAA
AACCAACAAAAAGCTTGTTGTCAAGAAGGAGGATATTGCTGAAGGTAAAGATAGACATAGACCTCATGACCGAGCTCTTA
AACCACCTAGCAATCCTGCTTCTCAAAAGAAATCGAACAATCCTTCAGACGTATCAAGAAACAAGAGTCGACGTTCCAGC
AGGTTGAGCTCAAGCTCTAGTAGTGGTAGCCGAGAAAAGAAGTCCGGTGAGGCTAGTAGACCAAATGCCAAGAAGAAACT
CCGTCAACAAGACAACAACCTTGGTTCAGAGAATCATTCCTCTTCACAGGACACGCTTGGATCACTTAACCAACTTTCTA
CAGAGGAAACCACTTCTTCAGAGTTTCACAATCAAGGCCAATGTGACAATGGAGAAGTTTCATCTTGTGCTGCCACAATT
CACTATTCTCATGAGCCAGAAGCATCCCAAATCTCTCTTAAATCATTCCTATCCAGCTCCTCAGAGTTCATCAACTACGC
AGAGGATCTTTTCGACTTCAACACCAACACTAAACGAAGCCGAGAATCAAACTTTCGAAATAGAGATAACATTGTGATAT
CAGACCAAAGACTAGCACTAGACTTTGCCAAAGAAGTAGCCAGACGCAAAAGCCTTCTACTAGCAGAACAACCGTGTCAC
ACAAGAAGCTCTTTGCACATTGATGAGGTGTTAATGGAAGTCTGTGATGGGTTTGAGTCTCTGGGAAGTTACAAAGACAC
GTTTTCAGGACAGAACAGCTTCGTTAAAGAGACCATTCACTTGGTGTTGGAGAAGGATTTAAAGGGTAAGAAGACAGAGA
TGACAAGTGGAGTATGGGATTTGGGTTGGAGAAGTGAGTTTCAGATTGATGAAACTTATCAAGCTGTAGTAGTTGACTTA
GAGAAACTTATCTTGTCCAGTTTGATCCAAGAAATTATCTCTTGA