Details for Lyrate rockcress Locus 16064160

Position : sca3 ( 5`- 572171 .. 569460 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064160

Protein [Map View]
MAENLRFLRMNRAVECAKQGALELGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDFVSASMVFDRMPLRDVVSWNKMIN
GYAKSNNMVKASFFFNMMPVRDVVSWNSMLSGYLQNGETLKSIEVFVDMGRAGTEFDGRTFAIILKVCSCLEDTSLGMQI
HGVVVRVGCDTDVVAASALLDMYAKGKRFVESLRVFQGIPEKNSVSWSAIIAGCVQNNLLSLALKFFKEMQKVNAGVSQS
IYASVLRSCAALSELRLGGQLHAHALKSDFAADGIVRTATLDMYAKCDNMQDAQILFDKSENLNRQSYNAMITGYSQEEH
GFKALLLFHRLMSSGLGFDEISLSGVFRACALVKGLSEGLQIYDLAIKSSLSLDVCVANAAIDMYGKCQALAEAFRVFDE
MRRRDAVSWNAIIAAHEQNGKGYETLFLFVSMLRSRIEPDEFTFGSVLKACTGGSLGYGMEIHSSIVKSGMASNSSVGCS
LIDMYSKCGMIEEAEKIHSRFFQRTNVSGTMEELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMMEMGITPD
KFTYATVLDTCANLASAGLGKQIHAQVIKKELQSDVYISSTLVDMYSKCGDLHDSRLMFEKSLRRDFVTWNAMICGYAHH
GKGEEAIQLFERMILENIKPNHVTFISILRACAHMGLIDKGLEYFYMMKRDYGLDPQLPHYSNMVDILGKSGKVKRALEL
IREMPFEADDVIWRTLLGVCTIHRNNVEVAEEATAALLRLDPQDSSAYTLLSNVYADAGMWEKVSDLRRNMRGFKLKKEP
GCSWVELKDELHVFLVGDKAHPRWEEIYEELGLIYSEMKPFDDSSFVPGVEVEEEDQWCYC*

DNA
ATGGCGGAGAATCTCAGATTCTTGCGTATGAACAGAGCAGTGGAATGTGCGAAGCAAGGAGCGTTAGAGTTAGGCAAGCA
AGCTCATGCTCATATGATTCTATCTGGGTTTCGTCCGACTACATTCGTGCTCAATTGTTTGCTGCAGGTGTACACAAATT
CAAGAGATTTCGTGTCTGCTTCTATGGTGTTCGACAGAATGCCGCTGAGAGATGTTGTTTCGTGGAACAAAATGATAAAT
GGTTACGCGAAGAGCAATAACATGGTTAAAGCGAGTTTTTTCTTCAATATGATGCCTGTGAGAGATGTTGTGTCTTGGAA
CTCAATGCTTTCTGGGTATCTTCAGAACGGTGAGACTTTGAAATCTATCGAGGTTTTCGTCGACATGGGGAGAGCAGGAA
CTGAATTTGACGGTAGAACTTTTGCAATTATTCTTAAAGTGTGTTCCTGTTTAGAGGATACCAGTTTAGGAATGCAGATT
CATGGGGTTGTTGTTCGAGTGGGTTGTGATACTGATGTGGTTGCTGCAAGTGCGTTGTTGGATATGTATGCAAAAGGCAA
GAGATTTGTCGAGTCTCTTAGAGTGTTTCAAGGTATTCCCGAGAAGAACTCTGTCTCGTGGAGTGCTATAATCGCAGGTT
GTGTTCAGAATAACTTGTTGTCCCTTGCTTTGAAGTTTTTCAAGGAGATGCAAAAGGTAAATGCTGGAGTGAGCCAGTCA
ATCTACGCTAGCGTCTTGAGGTCATGTGCTGCGTTATCCGAATTGAGGTTAGGCGGTCAGTTACATGCTCATGCCTTGAA
GTCAGATTTTGCAGCAGATGGTATAGTGAGGACGGCGACATTGGACATGTACGCAAAGTGTGATAATATGCAAGATGCTC
AAATTTTGTTTGACAAGTCAGAAAATCTTAATAGACAATCTTATAACGCAATGATTACTGGTTATTCGCAGGAAGAACAT
GGGTTCAAAGCTCTACTGTTGTTTCACCGGCTCATGTCATCGGGTCTTGGTTTCGACGAGATAAGTTTATCAGGAGTATT
CAGGGCTTGTGCCTTGGTGAAAGGACTTTCAGAGGGGCTTCAGATTTACGATTTGGCAATAAAAAGCAGCTTATCGCTGG
ATGTTTGCGTTGCAAATGCTGCTATTGACATGTATGGGAAATGTCAAGCTCTGGCTGAAGCCTTTCGTGTATTCGATGAG
ATGAGAAGACGTGATGCTGTGTCTTGGAATGCGATTATAGCTGCACATGAGCAGAACGGAAAAGGATATGAAACGCTTTT
TCTTTTTGTCTCGATGCTCCGTTCTAGGATCGAACCTGATGAGTTTACCTTTGGAAGCGTATTGAAAGCTTGCACTGGTG
GTTCTTTGGGTTACGGTATGGAGATCCATTCCAGCATTGTCAAATCAGGAATGGCTTCAAATTCCTCTGTCGGATGCTCT
CTGATCGATATGTATTCAAAGTGTGGAATGATAGAAGAGGCGGAGAAGATACATAGTCGATTCTTTCAACGAACCAATGT
CTCGGGAACAATGGAAGAGCTTGAAAAGATGCACAATAAGAGACTGCAGGAAATGTGTGTTTCATGGAATTCAATCATTT
CCGGATATGTAATGAAGGAACAAAGCGAGGATGCTCAGATGCTTTTTACCCGGATGATGGAGATGGGTATAACTCCTGAC
AAATTTACTTATGCAACAGTTCTTGATACCTGTGCGAATCTTGCTTCCGCTGGATTAGGTAAACAGATTCATGCTCAGGT
CATCAAGAAAGAATTGCAATCTGATGTGTATATCTCCAGCACCCTGGTTGACATGTACTCGAAATGTGGAGATCTCCATG
ATTCAAGATTGATGTTTGAGAAGTCGCTGAGAAGAGATTTCGTGACCTGGAACGCCATGATTTGCGGGTATGCACATCAT
GGGAAAGGAGAGGAAGCTATACAACTGTTTGAGAGAATGATACTCGAAAACATCAAACCGAATCACGTAACTTTCATATC
GATACTCCGAGCTTGTGCTCACATGGGTCTGATCGACAAAGGACTCGAGTACTTCTATATGATGAAGAGAGACTATGGCC
TGGATCCTCAGCTACCGCATTACTCGAACATGGTAGATATATTAGGAAAATCCGGAAAAGTCAAGAGAGCATTAGAGCTT
ATTCGAGAGATGCCATTTGAAGCAGACGATGTCATATGGAGAACCCTGTTAGGAGTCTGCACGATACATAGAAACAATGT
AGAGGTTGCAGAAGAAGCAACTGCTGCCCTGTTGAGATTGGATCCACAAGACTCTTCAGCTTATACACTTTTATCAAATG
TATACGCAGATGCAGGAATGTGGGAAAAGGTTTCAGATTTGAGGAGAAATATGAGAGGCTTTAAGCTTAAGAAGGAGCCT
GGTTGCAGTTGGGTTGAGCTAAAAGATGAGCTTCATGTGTTTCTCGTTGGAGATAAGGCTCATCCTAGATGGGAAGAGAT
TTACGAAGAGCTTGGTTTGATTTACAGTGAAATGAAACCTTTTGATGATTCTTCTTTCGTGCCTGGGGTTGAGGTTGAAG
AAGAGGACCAATGGTGTTACTGCTAA