Details for Lyrate rockcress Locus 16064154

Position : sca3 ( 5`- 1009481 .. 1010923 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064154

Protein [Map View]
MEQPTSPGTKSVNLRECMESLLRFTLSSHLDESVPSFDLDLTRDFCLHLLEEATDSTEKPAVYKLLARALSECLASEGDN
NPNLEKYSKLFHGLGHDLINMLKKVNFELHVQEPYFTQLKDGLKTVEGRCAVGDYMRISSGAFILFNKCLLLEVQDVHHY
TSFSEMLIMEGLAKVLPGVESIEEGVQVYRNFYSEEKERMNGVLAIHVAKPANQPYAALAGVLSELKSTGIKSLLDDYTA
*

DNA
ATGGAGCAACCAACGTCGCCGGGAACAAAGTCGGTGAATCTCCGAGAATGCATGGAGTCACTTCTACGTTTTACGCTGAG
CTCTCATTTAGACGAATCTGTTCCAAGTTTCGATCTTGACCTGACCAGAGATTTTTGCCTTCATCTCCTTGAGGAAGCGA
CAGATTCAACTGAAAAACCTGCGGTGTATAAGCTTCTAGCAAGGGCTCTCTCTGAATGTCTAGCTTCCGAGGGTGATAAC
AATCCTAACTTGGAAAAATACAGCAAATTGTTTCATGGCTTGGGACATGACTTAATAAATATGCTGAAGAAGGTAAACTT
TGAGCTTCATGTCCAAGAGCCTTACTTCACCCAATTGAAAGATGGTCTGAAAACTGTTGAAGGAAGATGTGCAGTGGGAG
ACTACATGAGGATCAGTTCAGGAGCTTTTATTTTATTCAATAAATGCTTGCTGCTTGAAGTTCAGGACGTTCATCATTAT
ACTTCATTCTCAGAAATGCTGATAATGGAGGGTCTTGCCAAAGTTCTTCCTGGAGTTGAAAGTATAGAAGAAGGTGTTCA
AGTTTATCGAAACTTTTACTCTGAAGAGAAGGAAAGAATGAACGGTGTTCTAGCAATTCATGTTGCGAAACCAGCTAATC
AGCCTTATGCAGCTTTGGCAGGAGTATTGTCTGAACTGAAGTCCACTGGGATCAAAAGCCTGTTGGATGACTATACAGCC
TGA