Details for Lyrate rockcress Locus 16064139

Position : sca3 ( 5`- 562182 .. 560093 -3` )
Annotation : [B2G] SEPALLATA2 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064139

Protein [Map View]
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEV
NNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHI
LLEANRALSMKLEDMIGVRHHHIGGAWEGGDQHNVAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTAQGQSQP
GHGYIPGWML*

DNA
ATGGGAAGAGGAAGAGTAGAGCTCAAGAGGATAGAGAACAAAATCAACAGACAAGTGACGTTTGCTAAACGTAGGAATGG
TTTGTTGAAAAAAGCTTATGAGCTTTCTGTTCTCTGCGATGCTGAGGTCTCTCTCATCGTCTTCTCCAACCGTGGCAAGC
TCTACGAGTTCTGCAGCACCTCCAACATGCTCAAAACACTGGAAAGGTATCAGAAGTGTAGCTATGGCTCCATTGAAGTC
AACAACAAACCTGCTAAAGAACTTGAGAACAGCTACAGAGAGTATTTGAAGCTGAAAGGTAGATATGAAAATCTGCAACG
TCAGCAGAGAAATCTTCTTGGAGAGGACCTTGGACCTCTGAACTCAAAGGAGCTAGAGCAGCTGGAGCGTCAACTAGACG
GCTCTCTGAAGCAAGTTCGCTGCATCAAGACACAGTATATGCTTGACCAGCTCTCTGATCTTCAAGGTAAGGAGCATATC
TTGCTTGAAGCCAACAGAGCTTTGTCAATGAAGCTGGAAGATATGATCGGCGTGAGACATCACCATATAGGAGGAGCATG
GGAAGGTGGTGATCAACATAACGTTGCATATGGACATCCTCAGGCTCATTCTCAGGGACTATACCAATCTCTTGAATGTG
ATCCCACTTTGCAAATTGGATATAGCCATCCAGTGTGTTCAGAGCAAATGGCTGTGACGGCGCAAGGTCAGTCCCAACCA
GGACACGGCTACATCCCTGGCTGGATGCTGTGA