Details for Lyrate rockcress Locus 16064103

Position : sca3 ( 5`- 10283527 .. 10285678 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479799 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064103

Protein [Map View]
MASMAAILSKTPFLSQPLTKPSPTSDIPFAAVSFPSKSLRRRNGSIRAGLIAPDGGKLVELIVEEPKRREKKHEAAELPR
VELTTIDLQWMHVLSEGWASPLGGFMRESEFLQTLHFNSLRLDDGSVVNMSVPIVLAIDDEQKARIGESKRVALFDSDGN
PVAILSDIEIYKHPKEERIARTWGTTAPGLPYVDEAITNAGNWLIGGDLEVLEPVKYNDGLDRFRLSPAELRKELEKRNA
DAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYKNPILLLHPLGGFTKADDVPLDWRMKQHEKVLEDGVLDPETTVVSIFP
SPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFRVAAYDKTQGKM
AFFDPSRPQDFLFISGTKMRTLAKNNENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVPV*

DNA
ATGGCTTCCATGGCTGCAATCTTAAGCAAAACTCCATTCCTCTCTCAACCACTCACCAAACCATCTCCAACCTCCGATAT
CCCCTTCGCCGCCGTATCCTTCCCTTCCAAATCCCTACGCCGCCGCAACGGATCAATCCGAGCAGGATTAATCGCGCCTG
ACGGAGGTAAGCTTGTAGAGCTCATCGTGGAAGAGCCAAAGCGACGGGAGAAGAAACACGAGGCGGCGGAGCTGCCACGT
GTTGAGCTGACGACGATTGACTTGCAATGGATGCATGTATTAAGCGAAGGCTGGGCAAGTCCACTCGGAGGTTTCATGAG
AGAATCCGAGTTCCTCCAAACTCTTCATTTTAACTCGCTACGTCTTGACGACGGCTCCGTCGTTAATATGTCGGTGCCTA
TTGTTCTCGCTATTGACGATGAGCAAAAAGCACGAATTGGCGAGTCTAAACGTGTCGCTCTTTTTGATTCCGATGGTAAT
CCCGTCGCTATCCTCAGCGACATTGAGATTTATAAGCATCCAAAGGAAGAACGGATAGCTAGAACATGGGGTACGACTGC
TCCAGGTTTGCCTTATGTAGATGAGGCGATAACTAATGCTGGAAACTGGCTTATTGGGGGTGATCTTGAGGTTCTTGAGC
CAGTTAAGTACAATGATGGGCTTGATCGTTTCAGGCTTTCGCCTGCTGAGCTTCGTAAAGAGTTGGAAAAGCGTAATGCG
GATGCTGTGTTTGCTTTCCAGCTGAGGAATCCGGTTCATAATGGTCATGCTCTTCTTATGACTGATACTCGTAGGAGACT
TCTTGAGATGGGATACAAAAACCCTATCCTTTTGCTTCATCCGTTAGGAGGGTTCACAAAGGCTGATGATGTTCCTCTAG
ATTGGAGGATGAAGCAACACGAGAAGGTGCTAGAGGATGGTGTTCTTGATCCAGAGACAACAGTGGTTTCGATATTCCCA
TCTCCTATGCATTATGCTGGTCCAACCGAAGTGCAGTGGCACGCAAAGGCTAGAATCAATGCTGGTGCTAACTTTTACAT
TGTGGGTCGTGATCCAGCCGGGATGGGTCATCCTGTAGAGAAACGTGATCTTTACGATGCTGATCATGGAAAGAAAGTAC
TAAGCATGGCACCAGGACTCGAACGACTCAACATCCTTCCTTTCAGGGTTGCTGCATATGACAAGACGCAAGGCAAGATG
GCTTTCTTCGATCCCTCGAGGCCTCAAGATTTCTTGTTCATCTCCGGCACTAAGATGCGCACATTAGCAAAGAACAACGA
AAACCCGCCAGACGGTTTTATGTGCCCAGGTGGATGGAAAGTTCTGGTGGATTACTATGAGAGCTTGACTCCAGCAGGTA
ATGGTAGACTACCGGAAGTGGTTCCGGTTTAA