Details for Lyrate rockcress Locus 16064101

Position : sca3 ( 5`- 2878564 .. 2878950 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064101

Protein [Map View]
MYQDRQGVVGGGGGGGSAPHGIILAVVVALVVLVPFFIGDGGEAITDAIAELLSPVGLLLLPIILLLTIQFLSSERGSFV
SAIFSTGEPESIHRVSGSPVGVALFLVLILFLLYYRFSIFGGDDGSDD*

DNA
ATGTATCAAGATCGGCAAGGCGTTGTAGGAGGCGGAGGCGGTGGCGGATCTGCGCCACACGGAATCATACTCGCCGTCGT
TGTTGCATTGGTAGTGCTTGTTCCCTTCTTCATCGGAGACGGTGGTGAAGCCATTACAGATGCGATCGCAGAGCTTCTTA
GTCCGGTGGGACTTCTCTTACTTCCCATCATCCTCCTCCTCACTATCCAGTTCCTCTCGTCGGAACGTGGTTCCTTCGTA
TCGGCCATTTTCTCCACCGGAGAACCCGAATCGATTCACCGGGTTAGCGGATCTCCCGTCGGTGTCGCTTTGTTCCTCGT
ACTGATCTTGTTCTTACTCTACTACCGCTTCTCCATCTTCGGCGGAGATGATGGTTCCGATGACTGA