Details for Lyrate rockcress Locus 16064098

Position : sca3 ( 5`- 7112872 .. 7113820 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897996 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064098

Protein [Map View]
MCGGAIISDFTPLVTKAKGRKLTAEELWSELDASAADDFWGFYSTSKLHPTNQVNVQEEPAKEQATEPATEKRRKRKNVY
RGIRKRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAMAYDVAAKQIRGDKAKLNFPDLHHHPPPTTSTSPSPPSRSTDQP
PAKKVCVASQSESELSLPSFPVECVGFGNVEEFQNLSYEFEPDYDLKQQISSLESFLELDGTTAEKPSQLDESVSEVDMW
MLDDVIASYE*

DNA
ATGTGTGGCGGTGCTATTATTTCCGATTTTACCCCTCTCGTCACCAAGGCCAAGGGCCGTAAACTCACGGCGGAAGAACT
CTGGTCAGAGCTCGATGCTTCCGCCGCCGACGACTTCTGGGGTTTCTATTCCACCTCCAAACTTCATCCCACCAACCAAG
TTAACGTGCAAGAGGAGCCAGCGAAGGAGCAGGCAACAGAGCCGGCGACGGAGAAACGGAGGAAGAGGAAGAATGTTTAT
AGAGGGATACGTAAGCGACCATGGGGAAAATGGGCGGCTGAGATTCGAGATCCACGCAAAGGTGTCAGAGTTTGGCTTGG
TACGTTCAACACGGCGGAGGAAGCCGCCATGGCTTATGACGTGGCGGCGAAGCAGATCCGTGGTGATAAAGCCAAGCTCA
ACTTCCCAGATCTGCATCATCATCCTCCTCCTACTACTTCTACTTCGCCGTCGCCACCTTCACGATCAACTGATCAGCCT
CCGGCGAAGAAGGTCTGCGTTGCCTCTCAGAGCGAGAGCGAATTAAGTCTGCCGAGTTTCCCGGTGGAGTGCGTTGGATT
CGGAAATGTGGAAGAGTTTCAGAACCTGAGTTACGAATTTGAACCTGATTACGATCTGAAACAGCAGATATCAAGTTTGG
AGTCGTTCCTTGAGCTGGACGGTACCACGGCGGAGAAACCGAGTCAACTCGATGAGTCCGTCTCCGAGGTGGATATGTGG
ATGCTTGATGATGTCATCGCGTCGTATGAATAA