Details for Lyrate rockcress Locus 16064083

Position : sca3 ( 5`- 3831270 .. 3829771 -3` )
Annotation : [B2G] 40s ribosomal protein s23
External links : CoGe
PGDD synteny : 16064083

Protein [Map View]
MGKPRGMGAGRKLKRHRINQKWADKYYKKSRQGNEWKKPFACSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKI
AAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS*

DNA
ATGGGTAAGCCACGTGGTATGGGAGCTGGGCGCAAGCTGAAGAGGCACCGGATTAATCAGAAGTGGGCCGACAAGTATTA
CAAGAAGTCTCGCCAGGGCAACGAGTGGAAGAAGCCTTTTGCTTGTTCTTCTCACGCTAAAGGAATCGTTCTTGAGAAAA
TTGGTATTGAGGCTAAGCAGCCTAACTCTGCTATCCGTAAGTGTGCTAGAGTTCAGTTGATCAAGAATGGTAAAAAGATT
GCTGCCTTTGTCCCCAATGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTGTTGATTGCTGGATTTGGGCGTAA
AGGTCATGCTGTCGGTGATATTCCCGGAGTTAGGTTCAAAGTGGTGAAGGTCTCTGGTGTCTCACTCTTGGCCCTTTTCA
AGGAAAAGAAGGAGAAGCCTAGGTCTTGA