Details for Lyrate rockcress Locus 16064073

Position : sca3 ( 5`- 3495187 .. 3487205 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064073

Protein [Map View]
MALGDLMVSRFSQSSVSLVSNHRYDEDCVSSHDDGDSRRKDSEAKSSSSYGNGTTEGAATATSMAYLPQTIVLCELRHDA
SEASAPLGTSEIALVPKWRLKERMKTGCVALVLCLNITVDPPDVIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYE
RWQPRARYKVQLDPTVDEVRKLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSI
YVFDCSAARMILNAFAELHDMGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCLTTPIKMALKWFCRRSLLKEI
IDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPHELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPM
LPPTHQHHMWDAWDMAAEICLSHLPQLVLDPTVEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFR
ALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQIDLVKDGGHTYFIRFLDSSGAF
PEQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEASRPSDPQPEPLFLQWLCLCLGKLWEDFMEAQIMGREANAF
EKLAPLLSEPQPEVRAAAVFALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAEVAVALARFA
FGHKQHLKLAAASYWKPQSSSLLTSLPSIAKFHDPGSATIVSLHMSPLTRASTDSQPVARESRISSSPLGSSGLMQGSPL
SDDSSLHSDSGMMHDSVSNGAVHQPRLLDNAVYSQCVRAMFALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKPTGRPGE
AATTSHTPLAGLARSSSWFDMHAGNLPLSFRTPPVSPPRTNYLSGLRRVCSLEFRPHLLSSPDSGLADPLLGVSGSERSL
LPLSTIYSWSCGHFSKPLLGGADASQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIANWDTRFETGTKTALLHPFSP
IVVAADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCLVNELDDSQLLVASCDGSVRIWKNYATKGKQKLVTGFSSIQ
GHKPGARDLNAVVDWQQQSGYLYASGEVSTVTLWDLEKEQLVRSIPSESECGVTALSASQVHGGQLAAGFADGSLRLYDV
RSPEPLVCATRPHQKVERVVGLSFQPGLDPAKVVSASQAGDIQFLDLRTTRDTYLTIDAHRGSLTALAVHRHAPIIASGS
AKQLIKVFSLQGEQLGRIRYYPSFMAQKIGSVSCLTFHPYQVLLAAGAADSFVSIYTHDNSQAR*

DNA
ATGGCATTAGGAGACTTAATGGTGTCTCGGTTCTCGCAATCTTCTGTTTCTTTGGTCTCCAATCACCGTTACGACGAAGA
CTGTGTTTCTAGTCACGATGACGGTGATTCACGGAGGAAGGATTCTGAGGCTAAGAGCAGTAGTAGCTACGGGAATGGTA
CAACGGAGGGAGCCGCCACCGCTACCAGCATGGCATACTTGCCTCAGACTATTGTGCTCTGCGAGCTTAGACACGACGCA
TCCGAGGCTTCTGCGCCCTTGGGGACTTCTGAGATCGCATTGGTCCCCAAATGGCGGCTTAAAGAACGAATGAAAACAGG
ATGTGTAGCTTTAGTTTTGTGTTTGAATATTACTGTTGATCCGCCGGATGTAATAAAGATATCTCCATGTGCTAGAATCG
AGGCATGGATAGATCCATTTTCCATGGCACCGCCTAAAGCTCTTGAGACAATTGGAAAAAATTTGAGTACTCAGTATGAG
AGATGGCAACCAAGGGCCCGCTATAAGGTTCAGCTAGATCCGACAGTAGATGAGGTGAGGAAGCTGTGCTTGACTTGTCG
GAAATATGCAAAGACCGAGAGAGTTCTATTCCATTATAATGGGCATGGTGTGCCAAAGCCTACAGCTAATGGTGAAATTT
GGGTATTCAACAAGAGTTATACACAGTACATTCCCTTGCCAATCAGTGAGCTTGATTCCTGGCTGAAGACACCCTCCATC
TATGTTTTTGACTGCTCTGCTGCTAGGATGATTCTTAATGCCTTTGCTGAGCTTCATGATATGGGTTCTTCTGGTTCCTC
TGGATCCTCAAGGGACTGCATTCTGCTTGCTGCTTGTGATGTACATGAGACACTTCCACAGAGCGTTGAGTTTCCAGCTG
ATGTTTTTACGTCTTGCCTCACAACGCCCATTAAAATGGCGTTGAAATGGTTCTGCAGGCGTTCGCTTCTGAAAGAAATC
ATCGATGAATCACTTATTGACCGGATTCCAGGCCGGCAAAATGACCGTAAGACATTGTTAGGGGAGTTGAACTGGATTTT
TACAGCAGTGACGGATACAATTGCATGGAATGTGCTTCCTCATGAACTTTTCCAGAGATTATTCAGACAGGACTTGTTGG
TCGCTAGCCTTTTCCGGAATTTCTTACTTGCTGAGAGAATAATGCGGTCCGCAAACTGTAATCCAATATCTCACCCTATG
CTGCCTCCTACGCATCAACATCATATGTGGGATGCATGGGACATGGCTGCTGAAATCTGTCTTTCTCACCTTCCCCAACT
TGTTCTGGACCCAACCGTAGAATTCCAGCCAAGTCCGTTTTTCACTGAGCAATTGACAGCTTTTGAGGTGTGGCTTGATC
ATGGATCTGAGCATAAGAAGCCACCGGAGCAGTTACCCATTGTTCTTCAGGTGTTACTTAGCCAGTGCCATCGGTTTCGT
GCTCTTGTACTTCTTGGAAGATTTCTTGATATGGGTTCATGGGCTGTGGATCTGGCCTTGTCTGTTGGAATATTCCCATA
TGTGCTGAAGCTTCTGCAAACAACAACGAATGAGCTAAGACAGATTCTGGTTTTCATATGGACAAAGATTCTTGCACTTG
ATAAGTCATGTCAAATTGATCTTGTGAAGGATGGGGGGCATACATATTTCATACGATTTCTAGATAGCTCGGGTGCATTT
CCAGAACAACGAGCTATGGCTGCTTTTGTTCTGGCTGTCATTGTTGATGGACATCGACGAGGCCAGGAAGCATGTCTTGA
AGCTAATTTAATTGGTGTTTGTCTGGGACACCTTGAAGCATCCAGACCAAGTGATCCACAGCCTGAACCATTGTTTCTAC
AATGGCTTTGTCTTTGTCTTGGAAAGTTATGGGAAGATTTTATGGAGGCCCAAATAATGGGCAGGGAGGCTAATGCTTTT
GAAAAGTTGGCACCTCTGCTTTCCGAGCCCCAACCTGAGGTAAGGGCTGCTGCTGTTTTTGCCCTGGGTACCTTGCTTGA
TATTGGGTTTGACTCTAATAAAAGTGTGGTGGAGGATGAATTTGATGATGATGAAAAGATTAGAGCCGAAGACGCTATCA
TTAAAAGTCTCTTAGATGTAGTTTCAGATGGGAGTCCACTTGTCCGAGCAGAGGTTGCCGTAGCTCTTGCACGTTTTGCC
TTTGGCCACAAACAGCACCTTAAGTTAGCCGCAGCTTCCTATTGGAAGCCTCAGTCAAGTTCTTTGCTTACTTCTCTCCC
TTCAATAGCTAAATTCCATGATCCTGGGAGTGCAACAATTGTTTCTTTACACATGAGTCCTCTGACTAGAGCTAGCACGG
ATAGCCAACCAGTGGCTCGTGAGTCTAGGATCTCAAGCAGCCCTCTTGGCTCTTCTGGGCTGATGCAAGGATCTCCATTA
TCTGATGATTCTTCATTACATTCTGATTCTGGAATGATGCATGACAGTGTCAGCAATGGAGCGGTCCATCAGCCAAGACT
GTTGGACAACGCTGTTTATTCGCAGTGCGTTCGAGCTATGTTTGCATTAGCTAAAGATCCATCTCCACGTATTGCAAGTC
TCGGACGGCGTGTGCTTTCTATTATTGGAATCGAACAGGTTGTTGCGAAACCCTCGAAGCCCACTGGCCGACCAGGGGAA
GCTGCAACGACATCTCACACTCCACTTGCTGGCCTAGCTCGTTCATCCTCATGGTTTGATATGCATGCAGGTAATCTGCC
CTTAAGTTTTAGGACTCCCCCGGTCAGCCCCCCTAGAACAAACTATCTAAGTGGACTGAGGAGAGTTTGTTCATTAGAGT
TCAGGCCTCATCTATTGAGTTCACCCGACTCAGGGTTGGCTGATCCGCTTTTAGGCGTCAGTGGATCTGAACGGAGTTTG
CTTCCACTATCAACTATCTACAGCTGGAGTTGTGGCCACTTTTCTAAACCGCTTCTTGGTGGTGCGGATGCTAGTCAAGA
GATTGCAGCCAAAAGAGAAGAGAAAGAAAAATTCGCACTTGAGCATATTGCAAAATGCCAGCACTCCTCTATTAGCAAGC
TCAACAATAATCCTATTGCCAACTGGGATACGAGGTTTGAAACGGGAACAAAGACAGCACTCCTTCACCCATTCTCTCCT
ATTGTAGTTGCTGCAGACGAGAATGAACGGATCAGAGTGTGGAACTATGAGGAAGCAACTCTTCTCAATGGCTTTGACAA
TCATGATTTTCCTGACAAAGGAATTTCAAAGCTTTGCCTCGTCAATGAACTTGACGACTCTCAGCTACTTGTTGCGTCAT
GCGATGGGTCGGTCCGGATATGGAAAAACTATGCAACTAAGGGTAAACAAAAGCTTGTTACTGGGTTTTCTTCAATCCAG
GGTCACAAGCCCGGTGCACGTGACTTGAACGCTGTTGTGGACTGGCAACAACAGTCCGGTTACCTGTATGCTTCTGGGGA
GGTGTCAACAGTCACACTTTGGGACCTGGAGAAAGAACAGCTTGTCAGATCTATTCCCTCTGAATCAGAGTGTGGAGTTA
CAGCACTTTCCGCTTCTCAAGTACACGGAGGCCAACTTGCTGCTGGTTTTGCCGATGGATCTTTGAGACTCTATGATGTT
CGGTCACCTGAACCGCTTGTCTGCGCGACTCGGCCTCATCAGAAAGTTGAAAGGGTGGTTGGACTCAGTTTTCAACCTGG
ACTTGATCCCGCAAAGGTGGTGAGTGCATCGCAGGCCGGTGACATACAGTTTCTTGACCTTAGAACAACAAGGGACACAT
ACCTGACAATTGATGCACACAGGGGTTCACTCACGGCTTTAGCTGTTCACAGACACGCTCCAATAATCGCGAGCGGATCT
GCAAAACAGCTCATTAAAGTGTTCAGCCTTCAAGGGGAACAACTAGGGAGAATCCGCTACTACCCGTCTTTCATGGCACA
AAAGATTGGTTCAGTGAGTTGCCTCACATTTCATCCGTACCAGGTTCTGCTAGCAGCTGGAGCTGCTGACTCATTCGTCT
CCATATACACCCACGACAACTCGCAAGCAAGATGA