Details for Lyrate rockcress Locus 16064066

Position : sca3 ( 5`- 7309781 .. 7310631 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064066

Protein [Map View]
MTHVEDDKAFKEEPLVQVLSDDDGEVKETKDGGEEITGGDGEGEANVEEEDDDADDDDDDDDDDDDDDEDDEEEKNVQEE
DLGTEYLVRPVGEVEDEDDASDFDPEENGVDEEDGDEDIEEDDVDEDISLSAGKSEPLSKRKRVAKDHNEQGDVTGDDV

DNA
ATGACGCATGTTGAAGATGATAAGGCATTCAAGGAGGAACCTTTGGTTCAGGTTCTTAGCGACGACGACGGTGAAGTGAA
GGAAACCAAAGACGGAGGTGAAGAAATTACCGGCGGCGACGGTGAAGGAGAGGCTAACGTAGAAGAGGAAGACGATGACG
CTGATGATGATGACGATGACGATGATGATGATGATGATGACGACGAGGACGATGAAGAAGAGAAAAACGTGCAGGAGGAG
GATCTTGGGACTGAGTACCTAGTGAGGCCGGTTGGTGAGGTTGAAGATGAGGATGATGCAAGTGATTTTGACCCTGAGGA
GAACGGGGTGGATGAAGAAGACGGTGATGAAGATATTGAAGAAGACGACGTTGATGAGGACATCAGCTTGAGTGCTGGCA
AATCTGAGCCTCTGTCCAAGAGGAAGAGGGTTGCTAAAGACCACAATGAGCAAGGAGATGTCACTGGTGATGACGTTAG