Details for Lyrate rockcress Locus 16064044

Position : sca3 ( 5`- 8434813 .. 8436235 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064044

Protein [Map View]
MTSRLEDDRKEFVSGQMDYCVKWPNPMVLISTMSKHQKEPLDCCPSTVYAHVLGLGVGCSSCAMVGLHRYNMLNGTNFQF
SALLKYNRSMNCVCSYYMTLDALDPCSQLQKTFQVRIDEKSFGDLDLTVSIARIKDEERVTTKKRFIHHFHGEADADDFY
QGPLPDWPSVDDLNDRKRFYLVNESELLANDWIHLYLELALYVKDRWIFRTSKPKLQILKVAIETKEDVEPPNGRLHVKS
AIFYITYKGMAKPPIGDEIGEDVERKAIVRRVIDEKTGYLTLLGGFSIAKNDLNQSVSGEDQSSDNEQGYGKRRRILYID
*

DNA
ATGACGTCTCGTTTGGAAGATGATCGGAAGGAGTTTGTCAGTGGGCAAATGGATTACTGCGTCAAGTGGCCAAATCCGAT
GGTTTTGATATCGACGATGTCCAAGCACCAGAAAGAACCACTGGACTGTTGTCCTTCAACTGTCTACGCCCACGTTTTAG
GCTTAGGTGTCGGTTGCTCAAGCTGTGCTATGGTGGGGCTTCATCGTTACAATATGCTCAATGGGACAAATTTCCAGTTC
TCTGCCTTACTGAAATACAACAGGTCAATGAATTGTGTCTGCTCTTACTACATGACTTTGGATGCACTAGATCCTTGTAG
CCAATTGCAGAAAACCTTTCAGGTTCGAATTGATGAAAAAAGTTTTGGAGATTTGGATTTGACGGTCTCTATTGCTAGAA
TTAAAGATGAAGAGAGAGTGACCACAAAGAAGCGTTTCATACATCACTTTCATGGTGAAGCAGACGCTGATGATTTCTAC
CAAGGTCCATTGCCTGATTGGCCATCAGTTGATGATTTGAATGATCGAAAACGATTTTACCTGGTAAATGAATCAGAGTT
GCTAGCCAATGATTGGATTCACCTGTATTTGGAACTTGCACTTTATGTAAAGGATCGGTGGATTTTTCGGACTTCTAAGC
CCAAGTTGCAGATTCTGAAAGTGGCGATAGAAACTAAGGAAGATGTGGAGCCACCGAATGGGAGACTCCATGTTAAGAGT
GCAATTTTCTACATAACTTACAAGGGCATGGCCAAGCCCCCGATTGGTGATGAGATTGGTGAGGATGTTGAACGCAAAGC
TATAGTTCGAAGAGTCATCGATGAAAAGACAGGATACTTGACTCTCCTCGGTGGGTTTTCGATTGCGAAAAATGATTTGA
ATCAATCTGTGAGTGGAGAAGATCAATCCTCTGACAATGAGCAGGGTTATGGAAAGCGACGTCGGATACTGTACATAGAT
TAG