Details for Lyrate rockcress Locus 16064018

Position : sca3 ( 5`- 7221733 .. 7220554 -3` )
Annotation : [B2G] at3g16920 k14a17_4
External links : CoGe
PGDD synteny : 16064018

Protein [Map View]
MVSKPLFSLLLLTVALVVFQTRSLVNAEDSEPSSSARKPRVKIVKGKTLCDKGWECKGWSEYCCNHTISDFFETYQFENL
FSKRNSPVAHAVGFWDYRSFITAAAEYQPLGFGTAGEKLQGMKEVAAFLGHVGSKTSCGYGVATGGPLAWGLCYNKEMSP
DQLYCDDYYKLTYPCTPGVSYHGRGALPVYWNYNYGQTGEALKVDLLSHPEYLENNATLAFQAAIWRWMTPPKKHLPSAH
DVFVGKWKPTKNDTAAKRTPGFGATINVLYGDQICNSGFDNDEMNNIVSHYLYYLDLIGVGREEAGPHEKLSCADQEPFS
SSSSAPTSSGSSS*

DNA
ATGGTTTCAAAACCGCTATTCTCCCTGCTGCTTCTCACGGTGGCATTAGTCGTGTTTCAAACCCGATCCCTAGTCAACGC
TGAAGATTCCGAGCCTTCGAGTTCCGCGAGAAAGCCTCGGGTGAAGATCGTCAAGGGGAAAACGTTATGCGACAAAGGAT
GGGAATGTAAAGGATGGTCCGAGTATTGTTGCAACCATACAATCTCCGATTTTTTTGAGACATATCAATTCGAGAATCTA
TTCTCTAAGCGTAACAGTCCAGTGGCTCACGCCGTCGGTTTTTGGGATTACCGATCATTCATAACCGCTGCTGCTGAGTA
TCAGCCTCTTGGTTTCGGTACTGCTGGTGAGAAACTTCAAGGCATGAAGGAAGTCGCTGCGTTTCTTGGCCACGTTGGAA
GCAAAACCTCATGCGGGTACGGGGTTGCGACGGGTGGGCCATTAGCTTGGGGATTGTGTTACAACAAGGAGATGAGTCCT
GATCAGCTCTATTGCGACGATTACTACAAATTGACGTATCCTTGTACTCCTGGTGTCTCGTACCACGGTAGAGGAGCTTT
ACCGGTTTACTGGAATTACAATTATGGTCAAACCGGGGAGGCTTTGAAAGTGGATCTACTGAGTCATCCAGAGTATCTTG
AGAACAATGCTACGTTGGCGTTTCAGGCAGCGATTTGGCGATGGATGACGCCACCGAAGAAGCATTTACCGTCGGCGCAC
GATGTTTTCGTCGGAAAATGGAAGCCGACGAAGAATGACACAGCGGCGAAACGAACTCCGGGGTTCGGAGCAACCATAAA
CGTTCTTTACGGCGATCAAATCTGCAACAGTGGATTCGATAACGATGAGATGAACAACATTGTTTCTCATTATTTGTATT
ATTTAGATCTGATAGGTGTTGGACGCGAAGAAGCTGGTCCTCACGAGAAGCTATCGTGCGCGGATCAAGAACCTTTCTCT
TCTTCTTCCTCTGCTCCTACAAGTTCTGGTTCCTCTTCTTGA