Details for Lyrate rockcress Locus 16063998

Position : sca3 ( 5`- 4799793 .. 4791202 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317971 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063998

Protein [Map View]
MTMMTPPPLDQQEDEEMLVPNPDLVEGPQPMEVAQTEPAASAVENPPPEDPPTLKFTWTIPIFTRLNTRKHYSDVFVVGG
YKWRILIFPKGNNVDHLSMYLDVADAANLPYGWSRYSQFSLAVVNQVNNRYSIRKETQHQFNARESDWGFTSFMPLSELY
DPTRGYLVNDTVLIEAEVAVRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTAS
IPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVVEGTIQKLFEGHHMNYIECI
NVDYKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLEGDNKYHAEGHDLQDAKKGVLFIDFPPVLQLQLKRFEYDFMR
DTMVKINDRYEFPLQLDLDRENGKYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDV
KRALEEQYGGEEELPQNNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEHLRVRLKKEQEEKEDKRKYKA
QAHLFTTIKVARDDDITEQIGKNIYFDLVDHEKVRSFRIQKQTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNR
PLLPNEELQTVGQIREASNKANNAELKLFLEIERGPDDLPIPPPEKSSEDILLFFKLYDPENAVLRYVGRLMVKSSSKPM
DIVGQLNKMAGFAPDEEIDLFEEIKFEPCVMCEQLDKKTSFRLCQIEDGDIICYQKPLSIQESECRYPDVPSFLEYVQNR
ELVRFRTLEKPKEDEFTMELSKQHTYDDVVERVAEKLGLDDPSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQT
SDILYYEVLDIPLPELQGLKTLKVAFHSATKDEVIIHNIRLPKQSTVGDVINELKTKVELSHQDAELRLLEVFFHKIYKI
FPSTERIENINDQYWTLRAEEIPDEEKNIGPNDRLIHVYHFTKEAGQNQQVQNFGEPFFLVIHEGETLEEIKTRIQKKLH
VPDEDFAKWKFASFSLGRPDYLQDTDVVYNRFQRRDVYGAWEQYLGLEHIDNAPKRAYAANQNRHAYEKPVKIYN*

DNA
ATGACTATGATGACTCCGCCGCCGCTTGATCAGCAGGAAGACGAGGAGATGCTTGTTCCGAATCCGGATTTGGTCGAGGG
ACCTCAGCCTATGGAAGTTGCCCAAACTGAGCCTGCTGCTTCCGCCGTGGAGAATCCGCCACCCGAGGATCCTCCAACTC
TGAAATTCACCTGGACCATCCCAATTTTCACTAGGCTCAATACCAGGAAGCATTACTCTGATGTATTTGTTGTTGGCGGT
TATAAATGGCGTATATTGATTTTTCCCAAAGGAAACAATGTCGACCATTTGTCAATGTACTTGGATGTTGCTGACGCCGC
GAATTTGCCGTATGGGTGGAGCAGATATTCACAGTTCAGTCTGGCTGTAGTGAATCAAGTCAACAACCGATATTCCATCA
GAAAGGAGACGCAACATCAATTCAATGCAAGAGAAAGCGATTGGGGCTTTACATCATTCATGCCTCTCAGCGAGCTCTAT
GATCCCACTCGAGGATATTTAGTGAATGACACTGTTCTGATTGAAGCTGAAGTTGCTGTGCGTAAAGTTCTTGATTACTG
GTCATATGACTCAAAAAAAGAGACTGGTTTTGTTGGACTAAAAAACCAAGGTGCTACCTGTTACATGAATTCTCTCCTGC
AGACTTTATACCACATACCTTACTTCAGAAAGGCTGTGTACCACATGCCAACGACTGAAAATGATGCACCTACTGCTAGT
ATCCCATTGGCGCTCCAGAGTTTGTTTTACAAGCTTCAGTATAATGATACCAGTGTAGCGACAAAGGAGCTGACAAAGTC
GTTTGGTTGGGATACATATGATTCTTTCATGCAACATGATGTCCAAGAACTCAACCGAGTTCTTTGTGAAAAGCTTGAGG
ACAAGATGAAGGGAACTGTTGTGGAGGGAACAATACAAAAGCTATTTGAGGGTCACCACATGAATTACATTGAGTGCATT
AATGTAGATTACAAATCTACACGAAAAGAATCATTCTATGACCTCCAGCTTGATGTCAAAGGCTGCAAAGATGTATATGC
TTCTTTTGACAAGTATGTTGAAGTTGAACGCCTTGAAGGAGACAACAAATACCATGCAGAAGGACATGATTTGCAGGATG
CAAAAAAAGGTGTTCTATTCATAGACTTTCCACCAGTTCTTCAACTTCAGCTCAAGAGGTTTGAATACGATTTTATGAGG
GACACAATGGTGAAGATCAATGATCGGTATGAGTTTCCTCTTCAACTGGATCTCGACAGAGAGAATGGAAAATATTTATC
CCCTGATGCAGACAAGAGTGTTCGCAATCTCTACACCCTCCACAGTGTCTTGGTTCACAGTGGAGGAGTGCATGGAGGGC
ATTATTATGCTTTTATTAGGCCAACACTTTCAGATCAGTGGTATAAATTTGATGATGAACGGGTAACGAAGGAAGATGTG
AAAAGGGCACTGGAAGAGCAATATGGTGGTGAAGAAGAGTTACCGCAGAATAATCCTGGTTTCAATAATCCACCTTTCAA
ATTCACAAAATACTCGAATGCATACATGCTTGTTTATATTCGGGAAAGTGACAAGGACAAGATAATCTGCAACGTTGATG
AGAAAGACATTGCGGAACATTTGCGGGTGAGGCTGAAAAAAGAACAAGAAGAAAAGGAAGATAAAAGAAAATACAAGGCT
CAAGCTCACCTTTTCACGACAATCAAGGTCGCAAGAGATGATGACATCACTGAGCAAATTGGAAAGAATATATATTTTGA
TCTTGTTGATCATGAAAAAGTTCGGAGTTTTCGAATCCAGAAACAGACCCCCTTTCAACAATTTAAGGAAGAGGTAGCCA
AAGAGTTTGGTGTCCCGGTTCAACTACAGCGGTTCTGGATCTGGGCAAAGCGTCAAAACCATACTTATCGCCCCAATCGT
CCCCTATTACCTAATGAAGAATTACAGACGGTTGGACAAATAAGAGAGGCATCTAACAAGGCAAACAATGCTGAACTAAA
GCTGTTTTTGGAAATAGAGCGTGGACCGGATGATCTTCCTATTCCTCCCCCAGAAAAATCTTCTGAAGATATCCTTCTTT
TCTTTAAACTCTATGACCCTGAGAACGCAGTACTAAGATATGTTGGCAGGCTAATGGTGAAAAGTTCCAGTAAGCCCATG
GATATAGTAGGGCAACTGAATAAAATGGCTGGTTTTGCTCCTGATGAGGAAATAGACCTTTTTGAGGAAATTAAGTTTGA
ACCTTGTGTAATGTGTGAACAACTGGATAAGAAGACTTCTTTCAGGCTGTGTCAAATTGAAGATGGAGATATCATTTGTT
ATCAGAAACCTCTATCTATCCAGGAGAGTGAATGTCGCTACCCAGATGTGCCATCATTTTTGGAGTATGTACAGAATCGA
GAGCTGGTGCGTTTTCGTACACTGGAAAAACCAAAAGAAGACGAATTTACTATGGAGCTGTCAAAGCAGCATACTTATGA
TGATGTTGTGGAAAGAGTGGCTGAGAAGCTTGGCCTTGATGATCCATCGAAACTTAGACTTACATCTCACAATTGCTACT
CCCAGCAACCCAAGCCTCAGCCAATCAAATACCGTGGAGTAGATCATCTTTCAGATATGTTAGTTCACTACAATCAGACG
TCTGACATTTTGTATTATGAAGTTCTGGATATTCCTCTTCCAGAATTGCAAGGTCTTAAGACTCTAAAAGTGGCTTTCCA
TAGTGCCACAAAGGATGAAGTGATAATCCACAATATCAGACTACCTAAGCAGAGTACTGTTGGAGATGTTATTAACGAAC
TGAAAACAAAGGTGGAGCTTTCGCATCAAGATGCAGAACTGAGGTTACTTGAGGTCTTTTTCCATAAGATCTACAAGATC
TTTCCATCTACTGAAAGAATTGAAAACATCAATGACCAGTACTGGACTTTACGAGCAGAAGAGATACCTGACGAAGAGAA
GAATATTGGTCCCAATGATCGGTTAATTCACGTATATCATTTTACTAAAGAGGCCGGACAAAATCAGCAAGTACAAAATT
TTGGGGAACCTTTCTTTTTGGTAATCCACGAAGGTGAAACTTTAGAAGAAATCAAGACCCGTATCCAAAAGAAACTCCAT
GTCCCTGATGAGGACTTTGCCAAGTGGAAGTTTGCATCTTTTTCATTGGGACGTCCTGATTACTTGCAGGACACAGATGT
TGTTTATAATCGCTTTCAGAGAAGAGATGTATACGGTGCGTGGGAGCAGTATCTTGGGTTGGAACACATTGACAATGCTC
CTAAAAGGGCTTATGCTGCGAATCAGAACCGACACGCATACGAGAAGCCGGTGAAAATATACAATTAG