Details for Lyrate rockcress Locus 16063983

Position : sca3 ( 5`- 8451500 .. 8450783 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063983

Protein [Map View]
MGRTEIAKAPKLLLRSWKQFQGRAGISSKAAKPNPMMVNYFEDISDHNLNCGGKEESWVPHPRTGIFFPPGQESVMEDVP
NGAASFNMTFWLRNVDGVDKPDPDLHHLPY*

DNA
ATGGGAAGAACTGAGATCGCCAAAGCACCAAAGCTGCTGTTAAGGAGTTGGAAGCAATTTCAAGGGCGAGCAGGGATAAG
CAGCAAAGCTGCAAAACCAAACCCGATGATGGTCAACTACTTTGAAGATATTTCCGACCACAATCTCAACTGTGGCGGCA
AAGAGGAGAGCTGGGTCCCACACCCCCGCACCGGAATATTCTTTCCGCCGGGACAAGAGTCAGTGATGGAAGATGTCCCT
AACGGTGCTGCCTCCTTCAATATGACGTTTTGGCTTAGGAACGTTGACGGTGTTGATAAACCTGATCCTGATCTTCATCA
TCTTCCTTATTAA