Details for Lyrate rockcress Locus 16063970

Position : sca3 ( 5`- 2073225 .. 2076203 -3` )
Annotation : [B2G] cell cycle checkpoint control protein family
External links : CoGe
PGDD synteny : 16063970

Protein [Map View]
MEFSISGNGLKTLARSIICLARVGNELVVQASPTQLALHTLNASRSAYQCITFQPSFFDVYTVSGPQAHFSLLLKAVCSV
LRTPLASIDHMSVQLPDHDASKVKWTLQCYSGMKKTYWITCNVEPDIQHLSLDRGRFPSTLVVHPRNLSKLLGNFQSSLQ
EITIIATDQTSFPSDAASEIGGKSVEFRSYVDPTKDGDALLHTQLWIDPSEEFLQYTHAGDPVDITFSLKELKAFLAFCE
GCEADIHLFFEKAGEPILMAPKFGLGDGSSSSFDATLVLATMLVSQLQEGIPAEPPEAANSTGGHAAEQVGSQPQERSRQ
NASVHPSDHTRVWSELSGTATKSVNGTEDRPQAQGQPDLDIQRIRNMEISKGGPAGDTAPAAPNSQRPTQIDHAEGSRVR
VQNQSFSQHHPSNWVDANEEEDDDEEGVEATPPHNEDY*

DNA
ATGGAGTTCAGTATCAGTGGCAATGGGCTCAAGACCTTGGCTAGGTCTATAATCTGCCTCGCACGCGTCGGCAACGAGCT
CGTCGTCCAAGCTTCGCCGACACAGCTGGCATTGCACACTTTAAATGCTTCACGTTCTGCCTATCAGTGTATTACATTTC
AGCCAAGTTTCTTTGATGTATATACTGTTTCTGGTCCTCAAGCTCATTTCAGTTTACTTTTGAAGGCTGTTTGTTCTGTT
CTTAGAACCCCTCTCGCCAGCATTGATCACATGAGTGTGCAGTTGCCAGATCATGATGCATCTAAGGTCAAATGGACTTT
GCAGTGTTACAGTGGTATGAAGAAAACATATTGGATTACTTGCAATGTGGAACCAGATATACAGCATCTGTCCCTTGATA
GGGGTAGATTTCCTAGTACCTTAGTCGTGCATCCTCGAAATCTGAGCAAGTTGCTTGGAAACTTCCAGTCATCCCTCCAA
GAGATTACAATAATTGCTACAGATCAAACTTCTTTCCCCTCTGATGCTGCAAGTGAAATAGGTGGAAAATCTGTTGAGTT
TCGGAGCTATGTGGATCCTACCAAAGATGGCGACGCTTTGTTACATACTCAGCTATGGATTGATCCATCAGAAGAATTTT
TGCAGTATACTCACGCAGGTGATCCCGTTGACATCACATTTTCCTTGAAGGAACTAAAGGCATTTCTGGCATTTTGCGAG
GGCTGTGAAGCTGATATTCATCTTTTTTTCGAAAAAGCTGGCGAACCAATACTGATGGCTCCAAAATTCGGTTTGGGTGA
TGGGTCAAGCTCCAGTTTTGATGCAACACTCGTTCTTGCGACAATGCTTGTGTCTCAACTTCAGGAAGGGATTCCGGCAG
AACCTCCTGAAGCAGCAAACTCCACAGGTGGCCATGCTGCCGAGCAAGTAGGATCACAGCCTCAAGAACGGTCTAGGCAA
AATGCCTCTGTGCACCCATCTGATCACACACGAGTTTGGTCTGAACTTTCAGGAACTGCCACTAAGAGCGTGAACGGTAC
TGAGGATAGGCCACAGGCTCAGGGACAACCAGACTTGGATATCCAAAGAATTAGGAATATGGAAATATCAAAAGGCGGGC
CAGCTGGAGATACTGCTCCTGCAGCTCCTAACTCCCAACGTCCCACACAGATAGATCATGCTGAAGGATCCCGAGTACGG
GTACAGAACCAAAGTTTCTCCCAGCACCATCCTAGTAATTGGGTAGATGCAAATGAGGAAGAAGACGACGACGAAGAAGG
TGTCGAGGCGACGCCACCTCACAATGAAGATTATTAA