Details for Lyrate rockcress Locus 16063955

Position : sca3 ( 5`- 8822669 .. 8822204 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063955

Protein [Map View]
MRIKLSVNSEKCRKKAMQVAVVANGVTSVAMEGEFQDELVVVGDGVDAASLIMALRKKACHVTLETLEEVKKPQVEEKSV
TPHCCIAQCPVVSNEQPRPEVYRIVHDSYGPTTGCLVM

DNA
ATGCGTATCAAATTGTCAGTGAACAGTGAAAAATGCAGGAAGAAGGCAATGCAAGTGGCAGTTGTTGCAAATGGTGTAAC
TTCAGTGGCGATGGAAGGGGAATTTCAGGATGAGCTTGTGGTTGTTGGAGATGGAGTGGATGCAGCGTCTTTGATTATGG
CCTTGAGGAAGAAAGCATGTCATGTCACTCTTGAGACTCTTGAAGAAGTGAAGAAGCCACAGGTCGAAGAGAAGTCTGTT
ACACCGCATTGCTGCATAGCTCAATGTCCTGTGGTTAGCAATGAGCAGCCAAGGCCTGAGGTTTATAGAATAGTGCATGA
TTCTTATGGTCCAACTACTGGGTGCTTAGTTATGT