Details for Lyrate rockcress Locus 16063887

Position : sca3 ( 5`- 8256525 .. 8250129 -3` )
Annotation : [B2G] ATPREP1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063887

Protein [Map View]
MLRTVSCLASRSSAPLFFRFFRQFPRSYMSLTSSTAALRVPSRNLRRISSPSVAGRRLFLRRGLRIPSAAVRSVNGQFSR
LSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGI
PHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFFPKCVDDVHTFQQE
GWHYELNDPSEDISYKGVVFNEMKGVYSQPDNILGRIAQQTLLIPENTYGVDSGGDPKDIPKLTFEEFKEFHRQYYHPSN
ARIWFYGDDDPVHRLRVLSEYLDMFEASPSPDSSKIKPQKLFSKPVRLVEKYPAGRDGDLKKKHMLCVNWLLSEKPLDLQ
TQLALGFLDHLMLGTPASPLRKILLESGLGEALVSSGLSDELLQPQFSIGLKGVSEDNVQKVEELIMDTLKKLAEEGFDN
DAVEASMNTIEFSLRENNTGSFPRGLSLMLQSIAKWIYDMDPFEPLKYTEPLKALKTRIAEEGSKAVFSPLIEKFILNNS
HRVTIEMQPDPEKATQEEVEEKNILEKVKAAMTEEDLAELARATEELKLKQETPDPPEALRCVPSLNLGDIPKEPTYVPT
EVGDINGVKVLRHDLFTNDIIYAEVVFDIGSLKHELLPLVPLFCQSLLEMGTKDLTFVQLNQLIGRKTGGISVYPLTSSV
RGKDEPCSKIIVRGKSMAGRADDLFNLMNCLLQEVQFTDQQRFKQFVSQSRARMENRLRGSGHGIAAARMDAMLNIAGWM
SEQMGGLSYLEFLHTLEKKVDEDWEGISSSLEEIRRSLLARNGCIVNMTADGKSLTNVEKSVAKFLDLLPEKPSGGLVTW
DGRLPLRNEAIVIPTQVNYVGKAGNIYSTGYELDGSAYVISKHISNTWLWDRVRVSGGAYGGFCDFDSHSGVFSYLSYRD
PNLLKTLDIYDGTGDFLRGLDVDQETLTKAIIGTIGDVDSYQLPDAKGYSSLLRHLLGVTDEERQRKREEILTTSLKDFK
DFAEAIDVVRDKGVAVAVASAEDIDAANNERSNFFEVKKAL*

DNA
ATGCTCCGAACAGTCTCTTGTTTAGCTTCGCGCAGCTCAGCCCCTCTATTCTTTCGCTTCTTTCGTCAGTTCCCTCGCTC
TTACATGTCTCTCACATCGTCGACGGCCGCTCTCCGTGTCCCCAGTCGCAATCTTCGCCGGATTTCCTCTCCTTCAGTTG
CCGGAAGACGTCTCTTTCTCCGCCGAGGTTTGAGGATTCCCTCCGCCGCAGTTCGTAGTGTCAATGGGCAGTTCTCTCGC
CTCTCTGTTCGCGCCGTCGCCACACAACCCGCACCACTTTATCCCGATGTAGGTCAAGATGAGGCTGAGAAGCTTGGATT
TGAAAAAGTGTCGGAAGAATTCATCTCAGAGTGTAAATCAAAGGCGATTCTCTTCAAACACAAGAAAACTGGTTGCGAGG
TGATGTCTGTGTCAAATGAGGATGAGAACAAGGTCTTCGGCGTTGTTTTCAGGACTCCTCCGAAGGATTCCACTGGCATT
CCGCACATACTGGAACATAGCGTTCTGTGTGGGTCAAGAAAGTACCCGCTAAAAGAGCCATTTGTTGAACTACTCAAGGG
AAGTTTGCATACTTTTCTAAATGCATTCACATATCCAGATAGGACCTGCTACCCAGTTGCTTCCACCAATACAAAGGATT
TTTACAATCTTGTCGATGTATATTTGGATGCTGTCTTCTTCCCCAAGTGTGTGGATGACGTGCACACCTTTCAGCAAGAG
GGCTGGCACTATGAGCTTAATGATCCCTCTGAAGACATATCTTACAAAGGTGTTGTTTTTAATGAGATGAAAGGTGTCTA
TTCACAGCCTGATAATATTTTAGGGCGAATTGCTCAACAGACCTTATTAATCCCAGAAAATACATATGGTGTTGACAGTG
GAGGTGATCCAAAAGATATCCCTAAGCTGACATTTGAGGAATTCAAGGAGTTCCACCGTCAGTATTATCACCCAAGCAAT
GCCAGGATCTGGTTCTATGGAGATGATGATCCCGTTCACCGCCTTCGTGTCTTGAGTGAATACTTGGACATGTTTGAAGC
AAGTCCATCTCCCGATAGTTCAAAGATTAAACCTCAAAAGTTATTCTCTAAGCCTGTCAGACTGGTTGAGAAATATCCTG
CTGGTCGAGATGGTGACCTTAAAAAGAAGCACATGTTGTGCGTTAACTGGCTATTGTCTGAGAAGCCCTTGGACTTGCAA
ACTCAGCTTGCACTTGGCTTCTTGGATCATCTTATGCTGGGGACTCCTGCTTCACCACTAAGAAAAATCTTATTGGAAAG
CGGTTTAGGAGAAGCTCTTGTCAGTAGTGGGTTGTCAGACGAACTATTGCAACCCCAGTTCAGTATTGGTTTGAAAGGTG
TGTCCGAAGATAATGTTCAAAAGGTTGAAGAGTTGATCATGGATACTCTGAAAAAGTTGGCAGAAGAAGGGTTTGACAAT
GATGCTGTGGAGGCATCCATGAATACAATTGAGTTTTCTCTGAGGGAAAACAACACAGGATCTTTCCCTCGTGGTTTATC
ACTTATGCTCCAATCTATTGCAAAATGGATATACGATATGGATCCTTTTGAGCCATTAAAGTATACGGAACCATTGAAGG
CCCTGAAAACCAGAATAGCTGAGGAGGGATCCAAGGCCGTCTTTTCCCCACTGATAGAGAAGTTTATCTTGAACAACTCG
CATCGTGTTACCATAGAGATGCAGCCTGATCCCGAAAAAGCTACTCAAGAGGAAGTGGAAGAGAAAAATATCCTGGAAAA
AGTTAAAGCAGCTATGACAGAAGAAGATCTTGCAGAGCTAGCACGTGCCACAGAGGAGCTAAAATTGAAACAAGAAACTC
CTGACCCTCCTGAAGCATTGAGATGTGTTCCAAGTTTGAACTTGGGTGACATTCCAAAAGAACCTACTTATGTTCCCACC
GAGGTTGGAGATATTAATGGTGTGAAGGTTTTGCGGCATGACCTTTTCACCAATGATATTATCTACGCTGAAGTAGTCTT
TGATATTGGTTCCCTGAAACATGAGCTTCTTCCACTAGTACCACTTTTCTGTCAATCATTACTGGAGATGGGCACAAAAG
ATTTGACTTTTGTTCAACTTAATCAGTTGATTGGAAGGAAAACGGGAGGGATATCAGTTTATCCCCTTACATCATCAGTT
AGGGGTAAGGATGAACCATGCAGCAAAATTATCGTACGCGGAAAATCCATGGCTGGGCGTGCTGACGACCTTTTTAACCT
GATGAATTGCTTGTTGCAAGAGGTTCAATTTACAGATCAGCAGAGGTTTAAACAGTTTGTCTCTCAAAGCAGAGCACGGA
TGGAGAACCGATTGAGGGGAAGTGGTCATGGAATTGCTGCGGCGAGGATGGATGCAATGTTGAACATTGCTGGATGGATG
TCTGAACAGATGGGTGGTCTCAGCTATCTTGAATTTTTACATACTCTTGAAAAGAAAGTGGATGAAGACTGGGAAGGAAT
TTCATCCTCACTTGAGGAGATCAGAAGATCTCTCCTTGCCAGGAATGGTTGCATAGTTAACATGACTGCTGATGGGAAGT
CTCTCACCAACGTCGAAAAATCTGTTGCGAAATTTCTAGATTTACTCCCTGAGAAGCCCTCCGGTGGGCTGGTCACTTGG
GATGGTCGACTTCCTCTCAGAAATGAAGCTATTGTGATACCAACCCAGGTAAACTATGTTGGAAAAGCAGGTAACATATA
CAGCACCGGATATGAGCTTGATGGCAGTGCATATGTTATATCAAAGCATATAAGCAATACATGGTTATGGGATCGTGTTC
GTGTAAGCGGTGGTGCATATGGAGGTTTCTGTGACTTCGATTCGCATTCAGGAGTATTTTCTTACTTATCTTACCGGGAT
CCAAACTTGTTGAAGACACTTGACATATATGATGGAACTGGAGATTTCTTACGTGGCCTTGATGTGGATCAAGAAACACT
CACTAAAGCTATTATAGGCACCATCGGTGATGTTGATTCATACCAATTACCTGATGCCAAAGGTTATAGCAGTTTGTTGA
GGCATTTACTCGGAGTAACTGACGAAGAACGGCAAAGAAAGCGTGAAGAGATATTAACAACAAGTTTGAAGGACTTCAAG
GATTTCGCAGAAGCAATAGATGTGGTTAGAGATAAAGGTGTTGCGGTGGCTGTGGCATCCGCAGAAGACATTGATGCAGC
AAACAATGAACGCTCCAACTTTTTCGAGGTGAAGAAAGCTCTCTAA