Details for Lyrate rockcress Locus 16063883

Position : sca3 ( 5`- 7636789 .. 7639506 -3` )
Annotation : [B2G] tetraticopeptide domain-containing thioredoxin
External links : CoGe
PGDD synteny : 16063883

Protein [Map View]
MVDANQVAELRRFIEQLKSNPSILHDPCLIFFKEYLRSLGAQVPKIEQTERDYEERAETKPSFSPKHADDDDDIMESDVE
LDNADVVEPDNEPPQPMGDPTAEVTDENRDEAQLEKSKAMEEISDGKFDEAIEHLTKAVMLNPTSAILYATRATVFLKVK
KPNAAIRDANVALQFNPDSAKGYKSRGMARAMLGQWEDAAADLHVASKLDYDEEIGTMLKKVEPNAKRIEEHRRKYQRLR
KEKELQRAERERRQQQEAQEREAQAALNDGQVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQ
HPRVVFLKVDIDEANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSSSK*

DNA
ATGGTGGATGCGAATCAGGTAGCTGAGCTTAGAAGATTCATCGAGCAGTTGAAATCGAATCCGTCGATTCTCCACGACCC
TTGTCTGATTTTCTTCAAAGAATATCTCCGAAGTTTAGGGGCTCAAGTTCCGAAGATTGAGCAAACTGAAAGAGATTATG
AAGAAAGGGCAGAGACAAAACCCAGTTTCTCTCCTAAACATGCTGATGATGATGATGATATTATGGAGTCTGATGTTGAA
CTGGACAATGCTGATGTAGTTGAACCTGACAATGAGCCTCCTCAGCCGATGGGAGATCCTACTGCTGAAGTGACTGATGA
AAATAGGGATGAAGCTCAGTTAGAGAAGAGCAAAGCTATGGAGGAAATCTCTGATGGGAAGTTTGACGAAGCTATAGAGC
ATCTAACAAAAGCCGTCATGCTAAACCCTACTTCAGCAATCCTCTACGCCACTAGAGCTACTGTGTTTCTAAAAGTTAAG
AAGCCAAATGCTGCAATTCGCGATGCCAACGTGGCGCTACAGTTCAACCCTGATTCAGCTAAGGGGTACAAGTCACGAGG
TATGGCTAGGGCCATGTTAGGCCAATGGGAAGATGCTGCAGCTGATCTACATGTAGCATCAAAATTAGATTACGATGAGG
AGATAGGGACGATGCTTAAGAAGGTTGAACCCAATGCAAAGAGAATCGAAGAACACCGCAGGAAATATCAACGCCTGAGG
AAAGAAAAGGAGCTCCAAAGGGCTGAACGTGAGAGACGACAACAGCAAGAAGCCCAGGAGCGAGAAGCTCAGGCTGCACT
CAATGACGGACAAGTGATTAGCATCCACTCAACAAGCGAGCTAGAAGCTAAGACAAAGGCCGCAAAGAAGGCATCGCGTC
TGCTCATCCTTTACTTCACAGCCACATGGTGTGGACCGTGCCGTTATATGTCTCCTCTGTACTCAAACCTGGCCACACAG
CACCCAAGAGTCGTTTTCCTGAAAGTTGACATAGACGAGGCCAACGACGTGGCTGCTTCTTGGAACATTAGCAGCGTCCC
GACCTTTTGCTTCATCAGAGATGGCAAAGAGGTGGACAAAGTTGTCGGAGCTGATAAAGGTTCGCTTGAGCAGAAGATTG
CACAGCACTCTTCTTCTAAGTAA