Details for Lyrate rockcress Locus 16063874

Position : sca2 ( 5`- 16552634 .. 16551106 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476650 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063874

Protein [Map View]
MAGRKDKIHKLRGSRIAVAILVGILIGCVCSVLFPNGFLNSESSSLIVNEERLSKSTSKDGLASCESSERVKMLKSDFAI
ISEENAELRKQVRELTEKVRLAEQGTDNARKQVLVLGSEIKAGSFGTVKSLRTNPTVVPDESVNPRLAKLLEKVAVNKEI
IVVLANSNVKPMLELQIASIKRVGILNYLIIALDDSVESFCESKEVSYYKRDPDKAVDMVGKSGGNHAVSGLKFRVLREF
LQLGYSVLLSDVDIVFLQNPFGHLYRDSDVESMSDGHDNMTAYGFNDVFDEPSMGWARYAHTMRIWVFNSGFFYLRPTLP
SIELLDRVAYTLSKSEAWDQAVFNEQLFYPSHPGYTGLHASKRVMDMYEFMNSKVLFKTVRKNHELKKLKPVIVHLNYHP
DKLERMQAVVEFYVNGKQDALDSFPDGSD*

DNA
ATGGCGGGTCGTAAAGACAAAATCCACAAGTTGCGTGGATCTCGAATTGCGGTTGCCATCTTGGTCGGAATTCTTATCGG
GTGTGTCTGTTCCGTCTTGTTCCCGAACGGCTTCTTGAACTCGGAATCATCATCGCTGATTGTTAACGAAGAACGCCTTT
CGAAATCAACCTCTAAGGATGGACTGGCTTCATGTGAATCGTCTGAACGGGTCAAAATGCTCAAATCAGACTTTGCAATT
ATCTCCGAAGAGAACGCAGAGTTAAGGAAGCAGGTCAGGGAGCTAACGGAAAAGGTACGGTTGGCGGAACAAGGAACGGA
TAATGCTAGGAAACAAGTCTTAGTTTTGGGATCAGAGATTAAGGCAGGATCTTTTGGCACTGTCAAGAGTCTGAGAACTA
ATCCAACTGTGGTTCCCGACGAGTCTGTTAACCCCAGATTAGCTAAGCTTTTAGAGAAAGTAGCTGTCAATAAAGAGATC
ATTGTGGTTCTTGCAAATTCAAATGTGAAACCAATGCTGGAGTTGCAGATTGCTAGCATCAAGAGGGTTGGTATTCTAAA
CTACCTAATTATCGCCTTGGATGATTCCGTAGAGAGTTTCTGTGAATCGAAGGAGGTTTCATATTACAAGAGAGATCCAG
ATAAAGCAGTTGACATGGTTGGGAAAAGCGGAGGTAATCACGCTGTTTCCGGACTGAAATTCCGTGTGTTAAGAGAGTTC
TTGCAGCTTGGCTACAGTGTTCTTCTATCGGATGTGGACATTGTATTTCTGCAGAACCCTTTTGGTCATCTGTACAGAGA
CTCTGATGTGGAGTCAATGAGCGATGGCCACGACAACATGACAGCGTATGGCTTCAACGATGTGTTTGATGAACCATCCA
TGGGATGGGCTCGGTATGCACACACAATGAGGATATGGGTTTTCAATTCAGGGTTTTTCTATCTAAGACCAACTCTTCCT
TCAATCGAGCTACTGGACCGAGTGGCTTATACACTCTCTAAGTCAGAGGCATGGGACCAAGCGGTTTTCAACGAGCAACT
CTTTTACCCTTCGCATCCCGGGTACACTGGCTTACACGCTTCCAAAAGAGTCATGGATATGTACGAGTTCATGAATAGTA
AGGTTCTCTTCAAAACCGTGAGAAAGAATCATGAACTGAAGAAATTGAAGCCGGTGATTGTTCATCTGAATTACCATCCA
GATAAACTCGAACGAATGCAAGCAGTAGTGGAGTTCTATGTTAATGGCAAACAAGACGCGCTTGATAGCTTCCCAGATGG
TTCAGATTGA