Details for Lyrate rockcress Locus 16063788

Position : sca3 ( 5`- 22130169 .. 22129198 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063788

Protein [Map View]
MATNASLESDSLLPPRKRLLAGFKKQNSKIGNESPSPPFASSSSITTSNGSSASTDVQTHLGHLLTSQLNDQTRSPEELA
QASKATAALAVKVAKAARATANEKAIIASKAVAAAKSALELFASFPVEAVACKERSRLSRAINNSPRVLTDCSGHRNKKQ
KTVTSTMYDGNDVAGVVDSDNRTRVNGKLLLCDNALKEKTGEESSSLGKRRGRVKLKKLPLSMCASKDQENGITLAENNV
SVSKPEGSNVGVGQVIEGPSWKCQDLKSPECVKQNKVVRS*

DNA
ATGGCGACAAATGCGAGCCTTGAATCCGATTCGCTTCTACCTCCACGGAAGCGTTTACTCGCCGGATTCAAGAAACAGAA
CTCGAAAATCGGCAATGAATCGCCGAGCCCTCCTTTCGCTTCTTCTTCTTCTATTACAACTTCAAATGGTTCCTCTGCCT
CAACAGATGTGCAGACTCATCTAGGCCATCTATTGACTTCTCAACTTAATGACCAGACTCGGTCTCCGGAAGAGCTAGCT
CAGGCGTCAAAGGCAACCGCTGCTTTAGCGGTTAAGGTTGCAAAGGCGGCGAGAGCTACTGCTAATGAGAAGGCCATCAT
TGCTTCAAAAGCAGTGGCGGCAGCGAAAAGTGCGTTGGAATTGTTTGCTTCTTTTCCCGTTGAGGCGGTTGCTTGTAAAG
AGAGGTCTAGGTTGAGTCGAGCTATAAACAATTCTCCTAGAGTCTTGACGGATTGTTCTGGTCACAGAAACAAGAAGCAA
AAGACCGTAACCAGTACTATGTACGATGGGAATGATGTTGCTGGTGTTGTAGATTCAGACAACAGAACCAGAGTAAACGG
GAAGCTGCTCTTATGCGATAACGCACTGAAGGAGAAAACAGGGGAAGAAAGTAGCTCATTGGGGAAAAGAAGAGGAAGAG
TGAAGTTAAAGAAGTTACCTTTGAGCATGTGTGCCTCTAAAGATCAAGAAAACGGTATCACATTAGCGGAAAACAATGTA
AGCGTAAGTAAGCCGGAAGGTTCTAATGTTGGTGTGGGTCAGGTCATAGAAGGACCATCATGGAAGTGTCAGGACCTAAA
GTCACCGGAATGTGTGAAGCAGAACAAAGTTGTACGTTCATAG