Details for Lyrate rockcress Locus 16063767

Position : sca2 ( 5`- 16415089 .. 16416044 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063767

Protein [Map View]
MAVVGAPISSPATHLQTKFISNPILPRFRRSFSTGKAPATFSVVSMAPQKKVNKYDAKWKKQWYGAGLFFEGSEQINVDV
FKKLEKRKVLSNVEKSGLLSKAEELGLTLSSLEKLKVFSKAEDLGLLSLLENLAGTSPAVLASAALPALTAAIVAVVLIP
DDSTTLVVAQAVLAGALALTGVVLLVGSVVLDGLQEAD*

DNA
ATGGCTGTCGTCGGCGCTCCGATATCGTCTCCGGCGACTCACCTGCAAACAAAATTTATCTCCAATCCCATTCTCCCTCG
CTTTCGCCGGTCTTTCTCCACCGGAAAAGCACCAGCAACTTTCTCCGTCGTCTCTATGGCTCCCCAGAAAAAGGTGAACA
AGTATGATGCCAAGTGGAAGAAACAGTGGTACGGAGCTGGATTGTTCTTCGAAGGGAGTGAGCAAATAAACGTCGACGTG
TTCAAGAAGTTGGAGAAGCGAAAAGTTCTGAGCAACGTTGAGAAATCTGGTTTGCTCTCAAAAGCAGAGGAGTTGGGACT
CACATTGTCATCTCTTGAGAAGCTTAAAGTCTTCTCCAAAGCAGAGGATCTTGGTCTTCTCAGTCTTCTTGAAAACTTAG
CTGGAACATCGCCTGCTGTCTTAGCCTCGGCTGCATTACCGGCTCTGACAGCTGCTATTGTCGCCGTGGTGTTGATCCCG
GATGACTCAACTACTCTGGTGGTTGCTCAGGCGGTTTTGGCCGGTGCTCTTGCGCTTACAGGCGTTGTTTTGTTGGTTGG
ATCTGTTGTTTTGGATGGACTTCAAGAAGCTGACTGA