Details for Lyrate rockcress Locus 16063688

Position : sca1 ( 5`- 7775955 .. 7777061 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_889272 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063688

Protein [Map View]
MFRVSNFVVGLANTLVMLVGASAIGYSIYMFVHQGVTDCESAIRIPLLTTGLILFLVSLLGVIGSCFKENVAMVSYLIIL
FSGIVALMVFSIFLFFVTNKGAGRVVSGRGYKEYRTVDFSTWLNGFVGGKRWVGIRSCLAEANVCDDLSDGRVSQIADAF
YHKNLSPIQSGCCKPPSDCNFEFRNATFWIPPTKNETAVAADNGDCGSWSNVQTELCFNCNACKAGVLANIREKWRNLLV
FNICLLILLITVYSCGCCARRNNRTARKSDSV*

DNA
ATGTTTCGAGTTAGCAATTTCGTGGTTGGTCTAGCCAACACATTGGTGATGTTAGTGGGCGCATCTGCCATTGGTTATTC
GATTTACATGTTCGTTCACCAAGGCGTCACCGATTGTGAATCTGCCATTCGGATACCACTTCTCACGACCGGGCTCATCC
TCTTCTTGGTGTCGTTACTCGGAGTGATAGGATCTTGTTTCAAGGAAAATGTCGCAATGGTTTCGTACTTGATCATATTG
TTTTCGGGCATCGTTGCGTTGATGGTTTTCTCCATATTTCTCTTCTTTGTGACTAACAAAGGAGCCGGTCGTGTGGTGTC
CGGTCGAGGGTATAAAGAGTACCGGACGGTGGATTTCTCGACTTGGCTTAATGGGTTCGTTGGTGGGAAGAGATGGGTTG
GGATAAGGTCTTGTTTGGCTGAGGCTAATGTTTGTGATGATTTGAGTGATGGTCGTGTTAGTCAGATCGCTGATGCGTTT
TATCATAAGAACTTGTCTCCCATCCAGTCAGGTTGTTGTAAGCCACCGTCGGATTGCAACTTCGAGTTCAGAAACGCGAC
GTTCTGGATACCACCGACCAAAAACGAAACGGCGGTTGCAGCCGACAACGGGGACTGCGGTTCGTGGAGCAACGTGCAAA
CGGAGTTATGTTTCAACTGCAACGCATGCAAAGCGGGTGTGTTAGCGAACATAAGAGAGAAGTGGAGGAATCTTCTTGTT
TTCAACATTTGTCTCCTCATTCTCCTCATCACCGTCTATTCCTGCGGTTGCTGTGCTCGTCGTAACAATCGGACGGCTAG
GAAAAGTGATTCTGTCTGA