Details for Lyrate rockcress Locus 16063629

Position : sca3 ( 5`- 6696542 .. 6691726 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063629

Protein [Map View]
MGTKFLALVLSLCLVLSSFYEVSCQDEGSGSLSTLDLIEHEYQTSVNSLQGNEVDQTETSGQKNSTSNNTISLSLSEEPV
ETVKESVDTSAELGAVTDEADKPSSMLDHIELEFEAHVNELKEAGSDGINKFDESKEDEEAARRHKMLEAIEREFEAAHA
GFEQLKTDDSTQGLDDEQSAKRQSMLDEIERDFEAATKGLEQLKADDITGVNDEEHAAKRQKMLEEIEREFEEATKGLEE
LRHSTSSTDDEAHSAKRQSMLDEIEREFEAATSGLKELKINAFTIKDDSSEIARCYAFFTDAKRQSMLDAIEREFEAVTE
SFKQLEDIADNKDEGDDQSAKRQSMLDEIEREFEAATNSLKQLNLDDFTEGDDNEQSAKRHSMLEAIEREFEAATKGLEE
LKANDSTSDKDDDEHVARRKIMLEAIEREFEAATRGLEELKNESEHAENNRKSMLEAIEREFEAATNAKTNGEDSAKNPS
TISTVQKTSGGYNAGLEGLLKPADGVCGCFNKDKDGLQADTDSSINIAEILAEESKLQGSGTSPLTTSLNNLVDTHRKET
SSKVGSVLGSSSSVTSTTSESAATSESIESLKQTLRKLRGLSARDLVNHPNFDAIIAAGTRYEVLSSASIGYISLLAKYK
TVIKEGLEASQRVQIAQTRAKLLKETAMEKQRTVDSVFAAAKTTAQRGDALHIRIVAIKKLLAKLEAEKVNVDSKFTSLT
TNLSELLKEASQAYEEYHEAVHKAKDEQAAEEFAVETTKRAEHIWVEFLSSLN*

DNA
ATGGGAACGAAGTTCTTAGCTCTGGTTTTGTCTCTGTGTCTTGTTCTCTCAAGCTTCTACGAAGTTTCTTGCCAGGATGA
AGGAAGTGGAAGTTTGAGTACTTTAGATCTAATCGAGCATGAATATCAAACTAGTGTCAATTCTCTCCAAGGCAATGAAG
TAGATCAAACTGAGACCAGTGGTCAGAAAAACAGTACAAGTAACAACACTATTTCTTTGTCTTTATCTGAAGAACCAGTG
GAAACTGTTAAAGAATCTGTTGATACATCAGCTGAGTTAGGAGCTGTTACTGATGAAGCCGATAAACCTTCGAGTATGTT
GGACCATATCGAACTTGAGTTCGAAGCACATGTCAATGAACTTAAAGAAGCTGGATCTGATGGTATCAACAAATTTGATG
AATCTAAGGAAGATGAAGAAGCTGCTAGGAGACATAAAATGTTGGAAGCCATTGAACGAGAGTTTGAAGCTGCTCATGCT
GGATTTGAACAACTAAAGACTGATGATTCCACCCAAGGATTAGATGATGAACAATCTGCAAAGAGACAAAGCATGTTGGA
TGAGATTGAACGTGACTTTGAAGCTGCTACAAAAGGTCTTGAACAACTAAAGGCTGATGATATAACCGGAGTCAACGATG
AAGAACACGCTGCAAAGAGACAAAAGATGCTGGAAGAGATCGAAAGAGAGTTTGAAGAAGCTACAAAAGGTCTTGAAGAA
CTAAGGCATTCTACCTCAAGCACAGATGATGAAGCACACTCTGCAAAGAGACAGAGTATGTTAGATGAGATTGAACGCGA
GTTTGAAGCTGCTACAAGTGGTCTTAAAGAGCTAAAGATTAATGCTTTCACTATCAAAGATGATTCTTCTGAGATAGCTA
GATGTTATGCCTTCTTTACAGATGCCAAAAGACAAAGTATGCTAGATGCAATTGAACGCGAGTTTGAAGCCGTTACTGAG
AGTTTTAAACAACTTGAAGATATCGCCGATAACAAAGATGAAGGAGACGACCAATCTGCAAAGAGGCAAAGTATGTTGGA
TGAGATTGAACGTGAATTTGAAGCTGCTACAAATAGTCTTAAGCAACTAAACCTTGACGATTTCACTGAAGGAGATGATA
ATGAACAATCTGCAAAGAGACATAGTATGCTTGAAGCTATAGAACGCGAGTTTGAAGCTGCTACAAAAGGTCTTGAAGAG
CTAAAGGCTAATGATTCAACCAGCGACAAGGATGATGATGAACACGTTGCAAGGAGAAAAATTATGCTTGAAGCTATTGA
ACGCGAGTTTGAAGCCGCGACAAGAGGCCTTGAAGAGTTAAAGAATGAATCAGAACATGCTGAAAACAATAGAAAGAGTA
TGTTGGAGGCAATCGAACGCGAATTTGAAGCTGCTACAAATGCAAAGACTAATGGAGAAGACTCTGCAAAGAATCCATCA
ACCATAAGTACAGTGCAGAAAACTTCTGGCGGATACAATGCTGGTTTAGAAGGTCTTCTAAAGCCTGCAGATGGTGTATG
TGGTTGTTTCAACAAAGACAAAGATGGCCTTCAGGCAGACACGGATTCTTCGATTAACATAGCGGAGATACTCGCTGAAG
AATCCAAATTACAGGGCTCAGGGACCTCTCCCCTCACCACATCATTGAACAATCTTGTTGATACTCACAGAAAAGAAACG
TCCTCAAAGGTAGGCTCAGTCCTTGGCTCATCTTCATCAGTTACTTCTACCACAAGCGAATCAGCAGCTACATCAGAGAG
CATAGAGAGCTTGAAGCAAACACTAAGGAAGCTACGCGGTCTAAGCGCACGTGATCTTGTAAACCACCCGAATTTCGATG
CGATTATAGCAGCCGGTACACGTTACGAGGTACTCAGCTCAGCTTCTATTGGTTACATCTCTTTGCTAGCCAAATACAAA
ACCGTCATTAAAGAAGGACTCGAGGCTTCTCAGAGAGTCCAGATTGCTCAGACCCGAGCGAAACTGCTAAAAGAAACCGC
AATGGAGAAGCAGAGAACCGTAGACTCGGTTTTCGCAGCAGCAAAGACCACTGCTCAACGAGGAGACGCGTTGCACATCA
GAATCGTGGCGATCAAGAAACTGTTGGCAAAGCTTGAAGCAGAGAAAGTGAACGTTGATTCAAAGTTCACCTCTTTAACA
ACGAATCTGTCAGAGCTTCTCAAGGAGGCTTCACAGGCTTACGAAGAGTATCACGAGGCGGTGCATAAGGCAAAGGACGA
GCAAGCGGCTGAGGAATTTGCGGTGGAGACGACAAAAAGAGCAGAACATATTTGGGTCGAGTTTCTTAGTTCACTTAATT
GA