Details for Lyrate rockcress Locus 16063617

Position : sca3 ( 5`- 22163029 .. 22160673 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063617

Protein [Map View]
MAANEEEPICRLSHPTRPHTLSRRAGRIPPLGCFACDKEEPSPCSTFHYSCTTCDVEFHDICHVYPRKFTHPYHLQHPLT
LTTQITEIEIISNQTEYGYIFKNVTVHWFRYKCSKTDCDDEITIQIDFRCILVPDCFTHKSHEHPLFISTSYSRKGYTFY
FDSVSMKILGNSSHTRPRGQLFEKDFCSWLCVWTSDIESLDNTGEE*

DNA
ATGGCTGCTAATGAAGAAGAGCCAATATGTCGTTTGTCTCATCCAACTCGCCCTCACACCCTCTCCCGTAGAGCCGGAAG
AATCCCTCCATTGGGTTGCTTCGCGTGCGACAAAGAAGAACCCTCACCATGTTCTACTTTCCATTACTCCTGCACCACTT
GTGATGTTGAGTTCCACGATATTTGTCACGTGTATCCGAGGAAGTTCACACACCCTTATCACCTTCAACATCCTCTCACC
CTCACCACTCAAATCACTGAAATAGAGATCATATCTAACCAAACCGAATATGGTTACATATTCAAAAATGTAACTGTCCA
CTGGTTTAGGTACAAATGCTCAAAAACTGATTGCGACGATGAGATAACGATTCAGATAGATTTTCGATGCATTTTAGTTC
CTGATTGTTTCACCCACAAAAGTCATGAACATCCTTTATTCATCTCCACATCCTATTCTAGAAAAGGTTACACGTTCTAT
TTCGACTCTGTATCCATGAAAATTCTTGGCAACAGTAGTCACACTCGGCCTCGCGGACAATTGTTTGAGAAGGATTTTTG
TTCATGGCTTTGTGTTTGGACATCCGACATCGAAAGTTTAGACAATACCGGAGAGGAATAA