Details for Lyrate rockcress Locus 16063605

Position : sca3 ( 5`- 6005906 .. 6005193 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063605

Protein [Map View]
MDQQLCLPRFLHLNKETLIFDPMAGLKRKFNKGHAFTSKCVSLVKEQRARLYILRRCATMLCCWYIHGDE*

DNA
ATGGATCAACAGCTATGTTTACCGCGTTTCTTACATTTAAATAAAGAAACCCTAATTTTCGACCCCATGGCAGGATTAAA
GAGAAAGTTTAACAAAGGTCATGCCTTTACAAGCAAATGTGTTTCCTTGGTGAAGGAACAACGAGCTCGACTCTACATTC
TCCGCCGTTGTGCCACCATGCTTTGCTGCTGGTACATCCATGGCGATGAGTAG