Details for Lyrate rockcress Locus 16063586

Position : sca3 ( 5`- 12385310 .. 12387166 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063586

Protein [Map View]
MNIFRLAGDMTHLASVLVLLLKIHTIKSCAGVSLKTQELYAIVFATRYLDIFTSFVSLYNTSMKLVFLGSSFSIVWYMRY
HKAVHRTYDREQDTFRHWFLVLPCLLLALLIHEKFTFLEVLWTFSLYLEAVAILPQLVLLQRTRNIDNLTGQYIFLLGGY
RGLYILNWIYRYFTEPHFVHWITWIAGFVQTLLYADFFYYYFLSWKNNKKLQLPA*

DNA
ATGAACATTTTCAGATTAGCTGGTGATATGACTCACCTAGCCAGTGTTCTGGTCTTGCTTCTCAAGATCCACACCATCAA
ATCCTGCGCTGGTGTTTCATTGAAGACTCAAGAACTCTATGCCATTGTCTTTGCGACGCGATATTTGGATATTTTCACGA
GTTTCGTGTCTCTCTATAACACCTCTATGAAGTTGGTGTTCTTAGGAAGTTCTTTTTCGATTGTTTGGTATATGAGGTAT
CATAAGGCTGTCCACAGGACTTACGACAGGGAGCAAGATACGTTTCGTCATTGGTTCCTTGTGCTTCCTTGCTTACTCTT
AGCTCTTTTGATACATGAAAAGTTTACCTTTCTCGAGGTTTTGTGGACGTTTTCATTGTACTTGGAGGCTGTTGCCATAT
TACCTCAGCTTGTCTTGTTGCAAAGGACTAGAAATATTGACAACTTGACCGGGCAATACATATTTCTCCTTGGGGGGTAC
CGTGGATTATACATCCTCAACTGGATCTACCGTTACTTCACTGAGCCGCACTTTGTTCACTGGATAACATGGATCGCCGG
GTTTGTTCAAACACTGCTCTATGCCGACTTCTTTTATTATTATTTCCTAAGCTGGAAGAACAACAAAAAGCTCCAGTTAC
CAGCTTAA