Details for Lyrate rockcress Locus 16063583

Position : sca3 ( 5`- 958884 .. 957562 -3` )
Annotation : [B2G] ATEXPA13 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063583

Protein [Map View]
MQRFLLPLLFLTLSPPAISHYSSSTSSPSSSSVSSDASEWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGLSE
TLFERGQICGACFELRCVDDLRWCIPGTSIIVTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMPVQ
YRRINCRREGSMRFTVDGGGIFISVLITNVAGSGDVAAVKIKGSRTGWLPMGRNWGQNWHINADLKNQALSFEVTSSDRS
TVTSYNVSPKNWNYGQTFEGKQFETP*

DNA
ATGCAACGGTTTCTTCTACCTTTACTCTTCCTTACACTATCGCCGCCGGCGATTTCTCATTACTCTTCCTCAACCTCTTC
TCCTTCTTCTTCATCCGTCTCTTCCGACGCCTCAGAATGGCGTCCAGCTCGAGCCACCTACTACGCCGCTTCTAATCCTC
GAGACGCGGTGGGTGGTGCGTGTGGATACGGAGATCTCGTCAAATCTGGGTACGGTATGGCTACTGTTGGTCTAAGCGAG
ACTCTGTTTGAGCGTGGTCAGATCTGTGGTGCTTGTTTCGAGCTCAGATGTGTTGATGATCTCCGTTGGTGTATCCCTGG
AACTTCAATTATTGTCACCGCTACGAATTTTTGTGCTCCTAATTACGGATTTGATCCAGATGGTGGTGGTCATTGTAATC
CACCTAACAAACATTTCGTGCTTCCGATCGAAGCGTTTGAGAAGATCGCTATTTGGAAAGCTGGGAACATGCCGGTGCAG
TATCGCAGGATCAACTGTAGAAGGGAAGGGAGCATGCGGTTTACAGTCGATGGTGGAGGCATTTTCATTTCGGTTCTGAT
CACCAATGTTGCAGGGTCCGGTGATGTAGCTGCTGTGAAGATCAAAGGGTCGAGAACCGGGTGGTTACCTATGGGTCGTA
ATTGGGGACAGAATTGGCATATCAATGCTGATCTCAAGAACCAAGCTCTCTCATTTGAGGTAACTTCTAGTGACAGGTCA
ACTGTGACATCTTACAACGTCTCCCCTAAAAACTGGAATTATGGACAGACCTTCGAAGGGAAACAATTTGAGACTCCGTG
A