Details for Lyrate rockcress Locus 16063573

Position : sca3 ( 5`- 5503454 .. 5496124 -3` )
Annotation : [B2G] MAPKKK7 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063573

Protein [Map View]
MTSSQFHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLNTIMQEIDLLKNLNHKNIVKYLG
SSKTKTHLHIILEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFG
VATKLNEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDDNPPIPDSLS
PDITDFLRQCFKKDSRQRPDAKTLLSHPWIRNSRRALQSSLRHSGTIKYMKEATASSEKDDEGSQDAAESLSAENVGMSK
SDSKSKLPLLGVSSFRSEKDQSTPSDLGEEGTDNSEDDIMSDQVPTLSIHEKSSDAKGTPEDVSEFHGKSERVETRENLE
TETSEARKNTSAKKQVGKELSIPVDQTSHSFGQKGEERGIRKAVKTPSSVSGNELARFSDPPGDASLHDLFHPLDKVSEG
KPNEASTSMPTSNVNQGDSPVADGGKNDLATKLRATIAQKQMEGETGHSNDGGDLFRLMMGVLKDDVIDIDGLVFDEKVP
AENLFPLQAVEFSRLVSSLRPDESEDAIVSSCQKLVAMFRQRPEQKAVFVTQHGFLPLMDLLDIPKSRVICTVLQLINEI
IKDNTDFQENACLVGLIPVVMSFAGPERDRSREIRKEAAYFLQQLCQSRILTLQMFIACRGIPVLVGFLEADYAKYREMV
HLAIDGMWQVFKLKRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASISGGAIVDGQAPRARSGQLDPNNPIFGQNE
TSLSMIDQPDVLKTRHGVGEEPSHASTSNSQRSDVHQPDALHPDGDRPRVSSVAPDASTSGTEDIRQQHRISLSANRTST
DKLQKLAEGTSNGFPVSQTEQVRPLLSLLEKEPPSRHYSGQLDYVKHITGIERHESRLPLLHGSNEKKNNGDLDFLMAEF
AEVSGRGKENGNLDTTTRYPSKTMTKKVLAIEGVASTSGIASQTASGVLSGSGVLNARPGSATSSGLLAHMVSTLSADVA
REYLEKVADLLLEFARADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILECTNHLSTDPNCLENLQRADAIKHLIPNLE
LKDGHLVYQIHHEVLSALFNLCKINKRRQEQAAENGIIPHLMLFIMSDSPLKQYALPLLCDMAHASRNSREQLRAHGGLD
VYLSLLDDEYWSVIALDSIAVCLAQDNDNRKVEQALLKQDAIQKLVDFFQSCPERHFVHILEPFLKIITKSYRINKTLAV
NGLTPLLISRLDHQDAIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQMATSLLKALH
INTIL*

DNA
ATGACGTCATCTCAGTTTCACAAATCAAAGACTCTTGACAACAAATATATGCTGGGAGATGAAATTGGTAAAGGAGCTTA
TGGTCGAGTTTATAAAGGATTAGACTTGGAGAATGGAGACTTTGTGGCCATTAAACAAGTCTCTTTGGAAAATATTGTTC
AAGAGGATCTTAACACCATAATGCAAGAAATTGATCTTTTGAAGAACTTGAACCATAAAAACATTGTGAAGTATCTTGGG
TCGTCGAAGACAAAGACTCACCTTCACATTATTTTGGAGTACGTTGAGAATGGCTCTCTTGCAAACATTATTAAACCAAA
TAAATTCGGACCTTTCCCAGAATCATTGGTGGCTGTTTACATTGCTCAGGTCTTGGAAGGTTTGGTATATCTGCATGAGC
AGGGTGTCATACACCGTGATATCAAGGGTGCAAATATTTTGACGACAAAGGAGGGTCTTGTGAAGCTTGCTGACTTTGGA
GTTGCCACTAAACTTAACGAGGCTGATGTTAATACTCACTCAGTGGTTGGAACTCCTTACTGGATGGCTCCTGAGGTTAT
TGAAATGTCAGGAGTTTGTGCTGCTTCTGACATTTGGAGCGTTGGATGCACTGTTATCGAACTTCTGACATGTGTGCCTC
CTTACTATGATCTGCAACCCATGCCAGCCCTCTTTCGTATTGTTCAGGATGATAACCCTCCTATTCCCGATAGTCTTTCT
CCAGATATTACTGACTTTCTACGACAGTGCTTCAAGAAGGATTCCAGGCAGAGGCCTGATGCAAAGACGCTACTCTCTCA
CCCTTGGATACGGAACTCTAGACGAGCATTGCAGTCATCACTTCGGCATAGTGGCACCATCAAATATATGAAGGAAGCCA
CTGCAAGTTCAGAGAAGGATGATGAAGGTAGTCAAGATGCAGCTGAAAGCCTTTCAGCAGAAAATGTGGGAATGTCAAAA
AGTGACTCGAAAAGCAAATTACCTCTGCTAGGGGTGTCGAGTTTTAGGTCCGAGAAAGATCAGTCTACACCCAGTGATCT
TGGTGAAGAAGGAACAGATAATTCAGAAGATGATATTATGTCAGATCAAGTTCCTACACTTTCGATCCATGAGAAATCTT
CGGATGCTAAGGGGACACCTGAAGATGTATCAGAGTTTCATGGGAAATCTGAACGTGTTGAAACACGTGAAAATCTTGAA
ACAGAAACTTCTGAAGCTAGAAAAAATACTTCAGCAAAAAAGCAGGTTGGCAAAGAATTATCCATCCCAGTGGACCAGAC
ATCACATAGTTTTGGCCAAAAAGGTGAAGAACGTGGGATTCGAAAGGCTGTGAAGACTCCATCTAGTGTTAGCGGGAATG
AACTGGCTAGGTTTAGTGATCCTCCTGGGGATGCTTCTTTGCATGATTTGTTTCATCCATTGGATAAAGTTTCGGAAGGA
AAACCAAATGAAGCCTCAACATCGATGCCTACATCAAATGTCAACCAAGGTGATTCTCCTGTCGCAGATGGTGGAAAGAA
TGATCTGGCTACAAAATTGAGGGCTACAATTGCTCAGAAGCAAATGGAGGGGGAAACAGGGCACTCAAATGATGGTGGTG
ATCTTTTTCGCTTGATGATGGGTGTTTTGAAAGATGATGTTATTGACATTGATGGCTTGGTATTTGATGAAAAGGTGCCC
GCGGAAAATCTTTTCCCTCTGCAGGCAGTCGAGTTCAGCAGATTGGTCAGCTCCTTAAGGCCTGATGAGTCAGAAGATGC
AATAGTATCTTCTTGTCAGAAACTTGTTGCCATGTTTCGTCAGAGACCTGAGCAGAAAGCAGTATTTGTGACACAGCATG
GTTTCCTGCCTCTTATGGATCTACTCGATATTCCTAAATCTCGAGTAATATGTACCGTGCTGCAGCTGATAAACGAAATT
ATTAAAGATAATACTGACTTCCAGGAAAATGCTTGTCTTGTTGGCCTCATTCCTGTTGTAATGAGTTTTGCTGGTCCTGA
GAGGGATCGTTCTCGAGAAATTCGTAAAGAAGCTGCTTACTTCTTGCAGCAGCTTTGTCAGTCAAGAATTTTGACGTTGC
AAATGTTCATAGCTTGCCGTGGAATACCCGTTTTGGTGGGATTTCTTGAAGCAGATTATGCCAAATACAGGGAGATGGTT
CACTTGGCTATTGATGGGATGTGGCAGGTATTTAAACTTAAAAGATCCACCCCAAGAAATGATTTCTGCCGTATAGCAGC
AAAGAATGGAATTCTTCTGAGGCTAATCAACACTCTTTATAGCTTGAATGAGGCAACCCGGCTGGCTTCTATATCAGGGG
GCGCGATTGTGGATGGTCAAGCTCCACGAGCGCGCTCTGGTCAACTTGACCCTAACAATCCTATTTTTGGTCAAAATGAG
ACTTCACTCAGTATGATTGATCAGCCTGATGTATTGAAAACCAGGCATGGGGTTGGTGAAGAGCCTTCTCATGCTTCAAC
CTCAAATTCTCAAAGATCAGATGTCCATCAACCAGATGCTTTGCACCCAGATGGTGATAGGCCTAGAGTAAGCAGTGTTG
CTCCAGATGCCTCAACGTCTGGCACAGAAGATATCAGACAACAGCATCGAATATCTCTCTCCGCCAATAGGACATCGACA
GATAAGCTTCAGAAGCTGGCAGAGGGCACCTCTAATGGTTTTCCTGTTAGTCAGACAGAACAAGTGCGACCTTTGCTTAG
CTTGTTGGAGAAAGAACCCCCTTCAAGACATTATTCTGGTCAACTGGATTATGTTAAGCATATCACTGGCATAGAGAGAC
ATGAAAGTAGACTTCCTCTTTTGCATGGATCAAATGAAAAGAAAAACAACGGAGACCTCGATTTTCTGATGGCTGAATTT
GCAGAGGTCTCTGGACGTGGAAAGGAAAATGGAAATCTTGATACTACGACTAGATATCCCAGTAAAACAATGACAAAGAA
GGTTCTGGCTATTGAAGGAGTTGCTTCTACTTCCGGGATTGCATCTCAGACAGCATCTGGAGTACTGTCAGGTTCGGGTG
TTCTAAATGCTAGACCTGGAAGTGCCACATCATCTGGTTTACTTGCCCATATGGTCTCTACCCTGAGTGCAGATGTTGCA
AGGGAATACTTGGAGAAAGTTGCTGACCTGCTTCTTGAATTTGCTCGAGCTGATACGACAGTAAAGTCATATATGTGCAG
CCAAAGCTTACTCAGTCGTCTTTTCCAGATGTTCAACCGTGTAGAACCTCCTATTCTGTTAAAGATACTGGAGTGCACAA
ATCATTTATCTACTGATCCAAATTGCTTGGAGAATCTGCAGCGTGCAGATGCAATTAAGCATTTGATCCCCAACCTTGAG
CTTAAGGATGGGCACCTTGTTTATCAGATCCATCATGAGGTGCTTAGTGCACTATTCAACCTGTGCAAGATAAACAAAAG
GAGGCAGGAACAAGCGGCTGAAAACGGAATCATTCCGCATCTGATGCTTTTCATCATGTCGGATTCTCCTCTGAAACAGT
ATGCATTGCCACTATTATGTGATATGGCTCATGCATCTCGGAATTCAAGAGAGCAGTTAAGGGCCCACGGGGGTCTGGAT
GTTTACCTGAGTTTACTCGATGATGAATATTGGTCCGTGATAGCCTTAGATTCAATCGCTGTTTGCTTGGCGCAAGACAA
TGACAACCGCAAGGTGGAGCAGGCCTTGCTCAAGCAAGATGCAATTCAGAAATTAGTTGACTTCTTCCAGAGCTGCCCAG
AGAGACACTTTGTGCATATATTGGAGCCATTCTTGAAAATTATCACGAAATCATATCGGATCAATAAGACATTAGCTGTA
AATGGATTGACTCCTTTACTTATTTCAAGGCTAGACCATCAAGATGCGATTGCTAGACTCAACCTCCTAAAACTCATCAA
GGCTGTTTACGAACATCATCCACGGCCGAAACAGCTGATTGTAGAGAACGACCTCCCTCAGAAACTGCAGAATCTAATAG
AAGAACGACGAGATGGACAACGTTCAGGAGGCCAAGTTCTGGTGAAGCAAATGGCAACATCTCTCCTCAAAGCACTTCAC
ATTAACACAATATTGTGA