Details for Lyrate rockcress Locus 16063496

Position : sca3 ( 5`- 7382124 .. 7378477 -3` )
Annotation : [B2G] methyltransferase family protein
External links : CoGe
PGDD synteny : 16063496

Protein [Map View]
MVWNLATLGLLLSFCLESLFQFVFFLSGILQGDLRRRNGNGGSSNHERNEQILFPKPETLDYELPCDTSYPHQIGDNAAS
SSGSNVKSLLIEMGFCPTLVQKAIDENGEDDIEFLLEILTKSTVTEQPGTSFHGLMEPKPEPDIEYETDGRRIALLTMQF
PENLVDFALDRLGKDAPIDEMVDFIVAAQLAEKYAEESEDSLDGAEINEEDEDVTPVTARGPEVPNEQLFETMDKTLHLL
EMGFSNDEISMAIEKIGTEGQISVLAESIVTGEFPAVCHDDLEDIEKKVSAAAPAANRACLSKSWRFVGVGAQKEDGCGG
SSSGTANIKPDPGIDSFPFPATANVGETSKGKRPKDEDENAYPEEYTDHDDRGKRLRPEYMGDSSSFMETPWMQDEWKDN
TYEFPSVMQPRLSQSLGPNVAKRPYFFYGQLGELSPSWWSKISGFLFGIHPEHVDTRLCSALHRTEGYLHNLPTVNRFNI
LPKPRLTIQDAMPQMKSWWPQWDIRKHFNSGTCSNRKDVTLLCERIGRRIAECRGKPTQQDQTLILRHCHTSNLIWIAPN
ILSPVEPEHLECIMGYPTNHTNIGGGRLAERLKLFDYCFQTDTLGYHFSVLKSMFPEGLTVLSLFSGIGGAEIALDRLGI
HLKGVVSVESCGLSRNILKRWWQTSGQTGELVQIEEIKSLTTKKLETLVQRFGGFDFVICQNPSTPLDLSKEISNSEACE
FDYTLFNEFARVTKRVRDMMELS*

DNA
ATGGTATGGAATTTGGCTACTTTGGGACTGTTGTTATCTTTTTGCCTGGAATCACTTTTTCAATTTGTTTTTTTTTTGTC
TGGAATTTTGCAGGGTGATTTGCGTAGACGAAATGGAAATGGAGGTTCCTCTAATCATGAAAGGAATGAGCAGATACTGT
TTCCAAAACCAGAGACTTTGGACTATGAATTGCCCTGCGACACCTCTTACCCTCACCAGATTGGTGACAATGCTGCTAGT
TCTTCTGGAAGCAATGTTAAGTCATTGCTGATTGAGATGGGATTTTGCCCAACTCTTGTTCAGAAAGCAATTGATGAAAA
TGGTGAAGATGATATTGAATTTCTATTAGAGATTCTCACTAAGAGTACTGTAACAGAACAACCTGGAACCAGCTTTCATG
GGCTAATGGAACCCAAACCGGAACCTGATATTGAATACGAAACTGATGGTAGAAGGATTGCGTTACTAACAATGCAGTTT
CCAGAAAATCTAGTTGACTTTGCACTGGATAGGCTTGGTAAAGACGCGCCAATTGATGAGATGGTGGACTTCATTGTTGC
TGCTCAATTAGCTGAAAAGTATGCAGAAGAATCTGAAGACTCACTTGATGGTGCTGAGATCAATGAAGAAGATGAAGATG
TCACTCCAGTTACTGCTCGGGGACCTGAGGTTCCCAACGAACAGTTGTTTGAAACAATGGACAAGACTTTGCATTTACTG
GAAATGGGATTCTCCAATGATGAAATTTCAATGGCAATTGAGAAGATAGGTACAGAAGGTCAGATTTCTGTCCTTGCTGA
GTCAATTGTTACTGGTGAATTTCCTGCTGTATGCCATGATGACCTTGAAGATATAGAAAAGAAAGTTTCAGCGGCGGCTC
CTGCAGCGAATCGTGCATGTCTTTCAAAGAGTTGGAGATTTGTTGGTGTTGGTGCCCAGAAAGAGGATGGTTGTGGGGGT
TCGTCGAGTGGCACTGCTAATATAAAACCAGATCCTGGTATTGACTCTTTTCCTTTCCCTGCCACTGCCAATGTGGGAGA
GACCTCGAAGGGTAAGCGACCAAAAGATGAGGATGAGAATGCCTATCCAGAGGAATACACTGACCACGATGACAGAGGAA
AACGGTTAAGACCCGAATATATGGGTGACTCAAGTTCGTTTATGGAAACCCCATGGATGCAAGATGAGTGGAAAGATAAC
ACATATGAATTTCCCAGTGTAATGCAGCCACGTTTGTCCCAGAGTCTTGGCCCAAATGTAGCCAAACGACCTTATTTCTT
CTATGGACAGTTAGGTGAACTATCTCCTAGCTGGTGGTCGAAGATCTCGGGTTTCTTGTTCGGAATTCACCCCGAGCATG
TAGATACTCGGTTGTGTTCAGCGCTCCATAGGACAGAAGGGTACCTGCACAATCTTCCCACTGTTAACAGGTTCAATATC
CTCCCAAAGCCTCGGTTAACTATACAAGACGCAATGCCACAAATGAAGAGTTGGTGGCCGCAATGGGATATCAGAAAACA
TTTCAATAGCGGCACGTGTTCTAATAGGAAAGATGTGACTCTTCTCTGTGAACGAATTGGACGCCGTATAGCTGAATGCA
GGGGAAAGCCTACTCAACAAGACCAGACTCTAATACTTCGACATTGTCACACATCCAATCTCATTTGGATTGCTCCAAAC
ATCCTCTCACCTGTGGAGCCTGAACATTTAGAGTGCATTATGGGATATCCAACGAACCACACAAACATCGGTGGTGGAAG
ATTGGCTGAAAGATTGAAGTTGTTTGATTACTGCTTCCAAACAGACACATTGGGTTACCATTTCTCTGTACTCAAGTCTA
TGTTTCCCGAAGGTTTAACAGTTTTATCACTCTTTAGCGGGATTGGTGGTGCGGAAATTGCATTGGACCGCCTTGGAATC
CATCTAAAAGGCGTAGTCTCTGTAGAGTCCTGTGGATTGAGCCGTAACATACTGAAAAGATGGTGGCAGACTTCTGGACA
AACCGGTGAGCTAGTGCAAATTGAAGAAATCAAAAGCTTAACGACAAAGAAGCTGGAAACTTTGGTGCAGAGATTTGGGG
GATTTGACTTTGTCATTTGTCAGAACCCATCAACACCACTTGATCTCTCTAAAGAAATCTCAAATAGCGAAGCCTGTGAA
TTTGATTATACGTTGTTTAACGAGTTTGCTCGTGTCACGAAACGTGTCAGAGATATGATGGAGTTAAGTTGA