Details for Lyrate rockcress Locus 16063444

Position : sca1 ( 5`- 29121560 .. 29122872 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063444

Protein [Map View]
MSEQTPKLFTNKPKKKAIIAQLKHVEANFNNPTVPPSSKPSPAAAAAASYTMGGGSVPPPPPPKESFARRYKYVWPLLLT
VNLAVGGYLFFRTKKKDIDPPLNEEIAAKLSSVAAPVTVEKTVSSTVVAEPVVVKAREPIPEKQQRELFKWMLEEKRKVN
PKNAQEKKRNDEEKAILKQFISSKTIPTL*

DNA
ATGAGTGAACAAACCCCCAAGCTTTTCACCAATAAACCCAAGAAGAAGGCCATTATCGCTCAGCTTAAGCACGTTGAAGC
CAATTTCAACAATCCCACCGTTCCTCCATCATCAAAACCGTCTCCAGCTGCTGCAGCCGCGGCTTCCTATACTATGGGTG
GTGGTTCTGTTCCTCCTCCGCCTCCTCCCAAGGAATCATTCGCTCGGAGGTACAAATATGTCTGGCCGCTTCTCCTTACC
GTCAATCTCGCCGTCGGAGGTTATCTTTTCTTTAGAACTAAGAAAAAGGACATAGATCCTCCTCTAAACGAAGAGATAGC
TGCTAAATTGAGTTCAGTCGCAGCTCCTGTTACTGTGGAAAAAACTGTGTCTTCTACAGTGGTTGCAGAGCCAGTGGTGG
TCAAGGCACGTGAGCCAATTCCGGAGAAACAACAACGTGAGCTCTTCAAATGGATGTTGGAGGAGAAAAGGAAAGTAAAT
CCCAAAAACGCACAAGAGAAGAAACGGAATGACGAAGAGAAAGCGATTCTGAAACAGTTCATAAGCTCCAAAACCATTCC
TACTCTCTGA